DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and AT5G02430

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_195863.1 Gene:AT5G02430 AraportID:AT5G02430 Length:905 Species:Arabidopsis thaliana

Alignment Length:800 Identity:200/800 (25%)
Similarity:345/800 (43%) Gaps:131/800 (16%)


  Fly   333 KLRDDFVMEFESSLNNATSSASNITLTCSS-------TNTVVSASASTSAAS------------- 377
            :..||....|:||  |..|:.....|..||       .:..:|.|::.|::|             
plant    26 EFEDDDDHFFDSS--NRISTVVPSDLASSSDEEEGEFDDCRISFSSNVSSSSRAAPAPDMSPDYD 88

  Fly   378 --SSLPSTIAIHMRPMVASVTIAGPKLTQSLGSSSTSVHSKPSPSNSAKSNS--APARVSSIDPN 438
              .|.|.:|....|.::..:.:...|  ..||:.|....|:|..:....|.|  |..:|...|.|
plant    89 IWMSAPGSITERRRRLLNGMGLESKK--TRLGAISIQRVSEPVAATGECSGSRVAEVKVEESDHN 151

  Fly   439 QGLNLFKAIQGG-----YVVKPRDEASNKAQGPSQDEIERIEKMLMESANRPKLAGTGSNSLGSS 498
            ..:|  :.::..     .:|:.|.::..:|   |..|.:|.|:||.:: ::.:|..|.|......
plant   152 SPVN--QRVRRSPSMSVLLVRSRSDSDIEA---SSAEKQRKEEMLGKT-SKSRLTRTASAIGAPC 210

  Fly   499 TRYPGFYRGVNDKERRKSAGDEDVLKQMNIYVRTRTSSGKQLTDFEILEQVPVKNLDTGENMPLS 563
            .|...::............|......|.:..:.:...|..:.:.|.:     :||||||:...:.
plant   211 ARICPYFTQTQASPPDAPNGHHQSQGQRSGPLLSSVVSNTRFSAFFL-----IKNLDTGKEFIVK 270

  Fly   564 EMRSPPVPEGWNPLSLHILKLTSHLEVIQKESDEESVIGIPPSIEGQQPDEEELETEDGSRLK-- 626
            |.....:   ||.||    .|.:..::..:|.  |..:|....::.....|....|.|..:..  
plant   271 EYGENGM---WNRLS----DLQTGKQLTMEEF--EKSVGYSSVVKDLMRRENANSTMDFRKFNSY 326

  Fly   627 -KKTARIKRFFGSTMRKTV-DKAKSIASEVSHARHKEDVAD------IVDAMNPEQNIKIKASSS 683
             .|:.|:.:..|:.:.|.: |.|.|::|.....:.|:....      :.:..|.:.|..:|...|
plant   327 VSKSLRVSKKRGAALLKNIKDVAHSMSSSKVSEKEKDSTGSGTSSPKVAEKNNEQANQWVKVRHS 391

  Fly   684 NKGPYEFTKLQHVQDLSGEDTSAVWCMKFSSCGRLLATAGQDKVLRIWVLKDA------------ 736
            .|...:.:.|...|::.... ..:|.||||....|||:||:|..:.:|.:::.            
plant   392 GKSHKDLSALHMCQEIQAHQ-GGIWTMKFSPDSHLLASAGEDCAIHVWEVQECEIMSMNEGSLTP 455

  Fly   737 -YPFFQDMRNK--------YNADQKSSPTPSQESLVSQ-----HSAEEAIAMATAAEKCTGPFMP 787
             :|......:|        .:.|:|.....|.....:|     |:.|...:::           .
plant   456 IHPSMSGSTDKSSEGDAAEVSQDKKKKGKTSMSKKGNQIPDYVHAPETVFSLS-----------D 509

  Fly   788 KPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVTAIAFHPRDDRY 852
            ||.|::.||..|:||:|||::..:||||||||||||.|..:.||..|.|.|:||.:.|:|.|:.|
plant   510 KPICSFTGHLDDVLDLSWSRSQLLLSSSMDKTVRLWDIETQSCLKLFAHNDYVTCVQFNPLDEDY 574

  Fly   853 FLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYH 917
            |:|||||.|:|:|||.:::|..||::   .:::||..:..:||.|.|||.:|.|..|:.:..|..
plant   575 FISGSLDAKIRIWNISNRQVVEWNDL---KEMVTAVCYTPDGQAAFVGSINGHCRLYSAEDCKLE 636

  Fly   918 TQIHVRSTRGKNRIGRKISGIEPMP-GEDKILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIK 981
            ....:.....|....:||:..:..| ...::||||.|||:|:.|  ...|..|::|:.|::||:.
plant   637 QTNQIDLQNKKKAQAKKITAFQFSPINPSEVLVTSADSRIRVLD--GTELVQKFRGFKNMNSQMT 699

  Fly   982 GSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAPHP---- 1042
            .|::.|.|:|:..||:..:|:||  |:..:|            ||........|..:...|    
plant   700 ASYTVDAKHIVCASEDSQVYVWK--HEEPRL------------GITGRKTVTMCTSYETFPCKDV 750

  Fly  1043 ------EAIIKPEPDEISNE 1056
                  ..::|.||....::
plant   751 SVAVPWNGVVKGEPPSTQHQ 770

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 7/43 (16%)
WD40 704..1101 CDD:225201 118/390 (30%)
WD40 704..1046 CDD:295369 115/379 (30%)
WD40 repeat 707..765 CDD:293791 17/79 (22%)
WD40 repeat 800..834 CDD:293791 20/34 (59%)
WD40 repeat 841..878 CDD:293791 19/37 (51%)
WD40 repeat 885..920 CDD:293791 12/35 (34%)
WD40 repeat 935..975 CDD:293791 14/41 (34%)
WD40 repeat 978..1003 CDD:293791 9/25 (36%)
WD40 repeat 1034..1069 CDD:293791 5/33 (15%)
AT5G02430NP_195863.1 WD40 347..779 CDD:225201 130/455 (29%)
WD40 405..722 CDD:295369 109/334 (33%)
WD40 repeat 414..459 CDD:293791 13/45 (29%)
WD40 repeat 504..556 CDD:293791 26/63 (41%)
WD40 repeat 563..599 CDD:293791 19/36 (53%)
WD40 repeat 604..641 CDD:293791 12/37 (32%)
WD40 repeat 654..690 CDD:293791 13/38 (34%)
WD40 repeat 697..721 CDD:293791 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I1170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoInspector 1 1.000 T124306
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14221
Phylome 1 0.910 0.658 Consistency score
66.070

Return to query results.
Submit another query.