DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and AT3G15470

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_566515.1 Gene:AT3G15470 AraportID:AT3G15470 Length:883 Species:Arabidopsis thaliana

Alignment Length:873 Identity:234/874 (27%)
Similarity:398/874 (46%) Gaps:173/874 (20%)


  Fly   342 FESSLNNATSSASNITLTCSSTNTVVSASAS---TSAASSSLPSTIAIHMR----------PM-- 391
            |..||:...||:|   .:||::|:...:.:|   :||||...........|          ||  
plant    18 FYESLDRLASSSS---CSCSASNSDYDSESSPRISSAASHDSEELYGGGRRRRYPFPVPRFPMGA 79

  Fly   392 ---------VASVTIAGPKLTQSLGSSSTSVHSKPSP----SNSAKSNSAPARVS-SIDPNQGLN 442
                     .|||:....||...:|.|...|.|:..|    |:|..:.:|...:| ||..||   
plant    80 SKFDVWTSEPASVSERRSKLLNEMGLSRDPVLSRLKPVSDSSSSKDTGAAGFEISRSISCNQ--- 141

  Fly   443 LFKAIQG----------GYVVKPRDEASNKAQGPSQDEIER-----------IEKMLMESANRPK 486
            |.:...|          ..:|:.:.:.:....|   |...|           :.|:.:..::..:
plant   142 LARRDHGECSESVGGCASCIVRSKSDITTSQCG---DRDRRYTSPGNPCSCSVSKLSVHHSSHSE 203

  Fly   487 LAGTGSN----SLGSSTRYPGFYRGVNDKERRKSAGDEDV----LKQMNIYVRTRTSSGKQLTDF 543
            ::.|.|.    |:||.:.......|.:|...|:|..:|:|    :|.::        :||:....
plant   204 ISRTSSPFVNCSVGSVSADSLRLNGDSDCVLRESVVNEEVEVCTIKNLD--------NGKEFVVN 260

  Fly   544 EILEQ---VPVKNLDTGENMPLSEMRSPPVPEGWNPLSLHILKLTSHLEVIQKESDEESVIGIPP 605
            ||.|.   ..||.:.||..|.:.|..                ....|..::|:....::|.....
plant   261 EIQEDGTWKKVKEVGTGTQMTMEEFE----------------MCVGHSPIVQELMRRQNVEDSDK 309

  Fly   606 SIEGQQPDEEELETEDGSRLKKKTARIK--RFFGSTM------RKTVDKAKSIASEVSHARHKED 662
            :...:..|......::.|:.|||.:..|  :...|:|      |::.|. :..:||....|....
plant   310 NTSKENEDSGNSNKDNASKSKKKGSWFKSIKSVASSMTGHSKERRSSDD-RDTSSERGGRRSSSA 373

  Fly   663 VADIVDAM--NPEQNIKIKASSSNKGPYEFTKLQHVQDLSGEDTSAVWCMKFSSCGRLLATAGQD 725
            ..|..::.  .||   :::.....|...|.|.|...|::...:.| :|.:|||..|:.||:||:|
plant   374 TDDSQESSFHGPE---RVRVRQYGKSSKELTALYKTQEIQAHNGS-IWSIKFSLDGKYLASAGED 434

  Fly   726 KVLRIWVLKDAYPFFQDMRNKYNADQ--------KSSPTPSQESLVSQHSAEEAIAMATAAEKCT 782
            .::.||.:.:|     :.:.:...|:        ..||.|:  ::..:.....:|:..:.:  ..
plant   435 CIIHIWQVVEA-----EKKGELLLDRPELLLLATNGSPEPT--TMSPRRRGRTSISRKSLS--LE 490

  Fly   783 GPFMP--------KPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDF 839
            ..|:|        ||||::.||..|:||::|||:..:||||||||||||::|.:.||..|.|.|:
plant   491 NIFVPDSLFGLSEKPFCSFQGHVDDVLDLAWSKSQHLLSSSMDKTVRLWNLSSQTCLKVFSHSDY 555

  Fly   840 VTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDG 904
            ||.|.|:|.|||||:|||||.|:|:|:|||::|..|.::.   :::|:|.:..:||..:||||.|
plant   556 VTCIQFNPVDDRYFISGSLDAKVRVWSIPDRQVVDWYDLH---EMVTSACYTPDGQGVLVGSYKG 617

  Fly   905 RCIFYNT--DQLKYHTQIHVRSTRGKNRIGRKISGIEPMPG-EDKILVTSNDSRVRLYDLRDL-N 965
            .|..|:.  ::|:..:||::::.: |....:||:|.:.:|| ..::||||:|||:|:.|..|| |
plant   618 SCRMYSASDNKLQQKSQINLQNKK-KKAHQKKITGFQFVPGSSSEVLVTSSDSRIRVVDGTDLVN 681

  Fly   966 LSCKYKGYLNVSSQIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDR----SDFWEGI 1026
               |.||:.|.||||..|.:.||||:::.||:..:||||.....|:.|....::    ::.:|..
plant   682 ---KLKGFRNTSSQISASITADGKYVVSASEDSHVYIWKYESPASRPSRSNNNKNVTVTNSYEHF 743

  Fly  1027 KAHNATVTCAIFAP----------HPEAIIKPEPDEISNEKLAHNQPDPL--------VEQHKKG 1073
              |:..|:.||..|          ...|......:.:.|...|::.|.|:        :...:.|
plant   744 --HSQDVSAAISWPGMASTENWGTQNRAGFNGSTNNLDNISTANHPPTPVDQLGTVERLNSPRNG 806

  Fly  1074 CGYVLVSADFNGAIKVFINKTKPKHSSL 1101
                ::|:..||.....::.|.|:...|
plant   807 ----IISSATNGYFFDRMSATWPEEKLL 830

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 8/39 (21%)
WD40 704..1101 CDD:225201 144/439 (33%)
WD40 704..1046 CDD:295369 134/376 (36%)
WD40 repeat 707..765 CDD:293791 17/66 (26%)
WD40 repeat 800..834 CDD:293791 20/34 (59%)
WD40 repeat 841..878 CDD:293791 22/37 (59%)
WD40 repeat 885..920 CDD:293791 13/37 (35%)
WD40 repeat 935..975 CDD:293791 19/42 (45%)
WD40 repeat 978..1003 CDD:293791 12/25 (48%)
WD40 repeat 1034..1069 CDD:293791 8/53 (15%)
AT3G15470NP_566515.1 WD40 350..728 CDD:225201 140/399 (35%)
WD40 406..717 CDD:295369 125/328 (38%)
WD40 repeat 417..511 CDD:293791 24/103 (23%)
WD40 repeat 516..550 CDD:293791 20/34 (59%)
WD40 repeat 557..593 CDD:293791 22/36 (61%)
WD40 repeat 598..641 CDD:293791 14/43 (33%)
WD40 repeat 649..685 CDD:293791 18/39 (46%)
WD40 repeat 692..716 CDD:293791 11/24 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I1170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoInspector 1 1.000 T124306
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14221
Phylome 1 0.910 0.667 Consistency score
66.070

Return to query results.
Submit another query.