DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and AT2G37670

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_001323654.1 Gene:AT2G37670 AraportID:AT2G37670 Length:904 Species:Arabidopsis thaliana

Alignment Length:833 Identity:215/834 (26%)
Similarity:365/834 (44%) Gaps:155/834 (19%)


  Fly   301 ISSSDQYSLPPADNEDTDSDTRSVKSVQGLQQKLRDDFVMEFESSLNNATSSASNITLTCSSTNT 365
            :||:..:.:..|.:.|.|.|.              ||..:.|.|::::.|:::........|.:.
plant    39 LSSALTFDMANASSSDEDEDF--------------DDCRLSFSSAVSSLTTASRKFRTPAMSPDY 89

  Fly   366 VVSASASTSAASSSLPSTIAIHMRPMVASVTIAGPKLTQSLGSSSTSVHSKPSPSNSAKSNSAPA 430
            .:..:|         |.:|:...|.::..:.:|..|...|..|....|.:.|..||..:......
plant    90 DIWMAA---------PGSISERRRRLLHGMGLASNKDMVSAVSIRRVVSNAPVVSNGEEKKMKKK 145

  Fly   431 RVSSIDPNQGLNLFKAIQGGYVVKPRDEASNKAQGPSQDEIER--IEKM----LMESANRPKLAG 489
            ....:|.....::...:               |:..|:.:|||  |||.    ::...::.:|..
plant   146 MNHEVDEQDHDHVPVML---------------ARSRSESDIERFLIEKRRKEEILGKISKQRLTR 195

  Fly   490 TGSNSLGSSTRYPGFYRGVNDKERRKSAGDEDVLKQMNIYVRTRTSSGKQLTDFEILEQVP---- 550
            |.|....:.||...:...:  ::.....|:...|:          ..|:.||......:|.    
plant   196 TYSTICPTRTRICQYQTPI--RQTPAVCGNGKALR----------GGGEALTSVMSNARVGAFFL 248

  Fly   551 VKNLDTGENMPLSEMRSPPVPEGWNPLSLHILKLTSHLEVIQKESDEESVIGIPPSIEGQQPDEE 615
            :||||||:...::|.....:   ||.||    .|.:..::..:|.  |..:|..|.:      :|
plant   249 IKNLDTGKEFIVNEYDEDGM---WNRLS----DLQTGKQLTLEEF--EKCVGYSPVV------KE 298

  Fly   616 ELETEDGSRLK--------------KKTARIKRFFGSTMRKTVDKAKSIASEVSHARHKEDVAD- 665
            .:..|:.:|:.              .|:.|:.:..|:.:.|.:   |.:|..:|.....:||:| 
plant   299 LMRRENVNRINYEPLMDLRKFNSYLSKSVRLSKRRGAALLKNI---KGVAHSMSLRVADKDVSDG 360

  Fly   666 -------IVDAMNPEQNIKIKASSSNKGPYEFTKLQHVQDLSGEDTSAVWCMKFSSCGRLLATAG 723
                   ..|..:.:.|..:|...:.|...|.:.|...|::...: .|||.:|||.....||:.|
plant   361 STDSPKKGKDHKHGKANEWVKVRPTGKSYKELSALHMCQEIQAHE-GAVWTIKFSQDAHYLASGG 424

  Fly   724 QDKVLRIWVLKDAYPFFQDMRNKYNADQKSSPTPSQESLVSQHSAEEAIAMATAAEKCTG----- 783
            .|:|:.:|.:::.         :..:..:.|.||...||..  |:...|.:....:|..|     
plant   425 ADRVIHVWEVQEC---------ELMSMNEGSLTPIHPSLCD--SSGNEITVVEKKKKGKGSSGRR 478

  Fly   784 ---------------PFMPKPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCC 833
                           .|..||.|:..||...:||:||||:..:||||||||||||.|..|.||..
plant   479 HNHIPDYVHVPETVFSFSDKPVCSLKGHLDAILDLSWSKSQLLLSSSMDKTVRLWDIETKTCLKL 543

  Fly   834 FQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAV 898
            |.|.|:||.|.|.|.|:.||||||||.|:|:|:|.|:.|..|:::.   :::|||.:..:||.|:
plant   544 FAHNDYVTCIQFSPVDENYFLSGSLDAKIRIWSIQDRHVVEWSDLH---EMVTAACYTPDGQGAL 605

  Fly   899 VGSYDGRCIFYNTD--QLKYHTQIHVRSTRGKNRIGRKISGIEPMP-GEDKILVTSNDSRVRLYD 960
            :||:.|.|..|:|:  :|....||.|:|.: |::..|||:..:..| ...::||||.|||:|:.|
plant   606 IGSHKGICRAYDTEDCKLSQTNQIDVQSNK-KSQAKRKITSFQFSPVNPSEVLVTSADSRIRILD 669

  Fly   961 LRDLNLSCKYKGYLNVSSQIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEG 1025
              ...:..|:||:.|..||:..|:|.||||||..||:..:|:||.:...::.:...:....|   
plant   670 --GSEVIHKFKGFRNTCSQLSASYSQDGKYIICASEDSQVYLWKNDFHRTRSTLTTQSHEHF--- 729

  Fly  1026 IKAHNATVTCAIFAP-HPEAIIKPEPDEISNEK-----LAHNQPDPLVEQHKK 1072
               |...|:.|:  | |.....:|.|.:|.:::     ...:||...:....|
plant   730 ---HCKDVSAAV--PWHGHVRGEPPPVQIHSKRHSKRISTSSQPSSTISSPTK 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 9/45 (20%)
WD40 704..1101 CDD:225201 135/399 (34%)
WD40 704..1046 CDD:295369 129/366 (35%)
WD40 repeat 707..765 CDD:293791 16/58 (28%)
WD40 repeat 800..834 CDD:293791 22/34 (65%)
WD40 repeat 841..878 CDD:293791 20/37 (54%)
WD40 repeat 885..920 CDD:293791 14/37 (38%)
WD40 repeat 935..975 CDD:293791 14/41 (34%)
WD40 repeat 978..1003 CDD:293791 13/25 (52%)
WD40 repeat 1034..1069 CDD:293791 8/41 (20%)
AT2G37670NP_001323654.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I1170
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoInspector 1 1.000 T124306
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14221
Phylome 1 0.910 0.629 Consistency score
66.070

Return to query results.
Submit another query.