DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and wdr26a

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_001921656.6 Gene:wdr26a ZFINID:ZDB-GENE-111027-4 Length:590 Species:Danio rerio

Alignment Length:692 Identity:147/693 (21%)
Similarity:231/693 (33%) Gaps:249/693 (36%)


  Fly   449 GGYVVKPR-----DEASNKAQGPSQDEIERIEKMLMESANRPKLAGTGSNSLGSSTRYPGFYRGV 508
            ||...:|:     .|:|:.|.|...      ...|:.|||         |.|.|||..|....|:
Zfish     7 GGQEPEPQLSCRNGESSSSAAGAVH------SNGLLSSAN---------NGLPSSTESPAPDTGM 56

  Fly   509 NDKERRKSAGDEDVLKQMNIYVRTRTSSGKQLTDFEILEQVPVKNLDTG---ENMPLSEMRSPPV 570
            . |::|.|..||||::.:          |:.|....:.:.|.:...::|   |:...::.|:..:
Zfish    57 K-KKKRLSQSDEDVIRLI----------GQHLHGLGLNQTVDLLMQESGCRLEHPSATKFRNHVM 110

  Fly   571 PEGWNPL--SLHILKLTSH----------LEVIQK--ESDEESVIGIPPSIEGQQPDEEELETED 621
            ...|...  .|:.||...|          |.:.||  |..|::.:     :|..|....||    
Zfish   111 EGEWEKAESDLNELKALMHSPSAVVRMKFLLLQQKYLEYLEDAKV-----LEALQVLRSEL---- 166

  Fly   622 GSRLKKKTARIKRFFGSTMRKTVDKAKSIAS-EVSHARHKEDVADIVDAMNP------------- 672
             :.||..|.||....|..|....:..:..|. |......:..:.|.:....|             
Zfish   167 -TPLKYNTERIHVLSGYLMCSNSEDLRLKAEWEGKGTASRSKLLDKLQTYLPPSVMLPPRRLQTL 230

  Fly   673 -EQNIKIKASSSNKGPYEFTKL-----------QHV----------QDLSGEDTSAVWCMKFSSC 715
             .|.::::   .::..|..|||           .||          |.:..|..:.||..|||:.
Zfish   231 LRQAVELQ---RDRCLYHNTKLDSGLDNVSLLIDHVCSRKQFPCYTQQILTEHCNEVWFCKFSND 292

  Fly   716 GRLLATAGQDKVLRIWVLKDAYPFFQDMRNKYNADQKSSPTPSQESLVSQHSAEEAIAMATAAEK 780
            |..||:..:|..:.||.:                      .|..:.|                  
Zfish   293 GTKLASGSKDTTVIIWQV----------------------DPDSQQL------------------ 317

  Fly   781 CTGPFMPKPFCTYNGHTSDLLDVSWSKN--YFILSSSMD-KTVRLWHISRKECLCCF--QHIDFV 840
                   |...|..||...:..::||.:  |.|.....| ..:.||::...|.....  .|.|.:
Zfish   318 -------KQLKTLEGHAYGVSYLAWSPDDTYLIACGPDDCSELWLWNVQTGELRTKMSQSHEDSL 375

  Fly   841 TAIAFHPRDDRYFLSG---------SLDGKLRLWNIPD-----KKVALWNEVDGQTKL------- 884
            |::|::| |.:.|::|         .|||     |:.|     :...||...||:|.|       
Zfish   376 TSVAWNP-DGKRFVTGGQRGQFYQCDLDG-----NLLDSWEGVRVQCLWCLGDGRTVLASDTHQR 434

  Fly   885 --------ITAANFCQNG----QFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISG 937
                    :|..|..|..    .|.|  |.:||....|.            :|:|          
Zfish   435 IRGYNFEDLTDRNIVQEDHPIMSFTV--SKNGRLALLNV------------ATQG---------- 475

  Fly   938 IEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKY----KGYLNVSSQIKGSFSHDGKYIIAGSENQ 998
                              |.|:||:|..|..||    :|:..:.|.. |.::.|  :|.:|||:.
Zfish   476 ------------------VHLWDLQDRVLVRKYQGVTQGFYTIHSCF-GGYNED--FIASGSEDH 519

  Fly   999 CIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAIFAP 1040
            .:|||   |..|:|....         :..|..||.|..:.|
Zfish   520 KVYIW---HKRSELPIAE---------LTGHTRTVNCVSWNP 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 10/72 (14%)
WD40 704..1101 CDD:225201 82/380 (22%)
WD40 704..1046 CDD:295369 82/380 (22%)
WD40 repeat 707..765 CDD:293791 13/58 (22%)
WD40 repeat 800..834 CDD:293791 8/37 (22%)
WD40 repeat 841..878 CDD:293791 13/51 (25%)
WD40 repeat 885..920 CDD:293791 9/39 (23%)
WD40 repeat 935..975 CDD:293791 9/44 (20%)
WD40 repeat 978..1003 CDD:293791 9/25 (36%)
WD40 repeat 1034..1069 CDD:293791 2/8 (25%)
wdr26aXP_001921656.6 CTLH 98..157 CDD:128914 12/64 (19%)
WD40 275..567 CDD:238121 83/386 (22%)
WD40 repeat 285..325 CDD:293791 14/87 (16%)
WD40 repeat 330..368 CDD:293791 8/38 (21%)
WD40 repeat 376..410 CDD:293791 11/40 (28%)
WD40 repeat 414..459 CDD:293791 10/45 (22%)
WD40 repeat 468..536 CDD:293791 25/123 (20%)
WD40 repeat 542..567 CDD:293791 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.750 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.