DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and WDR44

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_061918.3 Gene:WDR44 HGNCID:30512 Length:913 Species:Homo sapiens

Alignment Length:1181 Identity:438/1182 (37%)
Similarity:589/1182 (50%) Gaps:360/1182 (30%)


  Fly     4 LETDSDSSEEFFDA-EDT---------TPNR-----------------HSTLCRKLPPEVAQEFI 41
            :.::|| :|||:|| ||.         :|.:                 :.:..::|..:|:::.|
Human     1 MASESD-TEEFYDAPEDVHLGGGYPVGSPGKVGLSTFKETENTAYKVGNESPVQELKQDVSKKII 64

  Fly    42 --FPEPAVRV-----------NAAASSDSDATPIGAGTPATRSPTNSLGARLKPQDA------GV 87
              ..|.:.:|           ....|..:.|:||.|.|..:..|......::.|:::      ..
Human    65 ESIIEESQKVLQLEDDSLDSKGKELSDQATASPIVARTDLSNIPGLLAIDQVLPEESQKAESQNT 129

  Fly    88 FVEPKPVIGPLGRQRFHELRQCMQNDED-DNPGNTLTPDSQNSSTDGIFTNRSTHPFKVIETDAM 151
            |.|.:           .||::|..:||. :.|.:..|..:|.|||:.:....:       ||:.:
Human   130 FEETE-----------LELKKCFPSDETCEKPVDETTKLTQTSSTEQLNVLET-------ETEVL 176

  Fly   152 SIQSMTSLGRVGRILAGSIDPSAISIDRESLASLNAQQQKQQAQQQQQAQPTSSTSSNTPPSVGN 216
            :.:::...|. |.:|                                  :|.||.|.:|......
Human   177 NKEAVEVKGG-GDVL----------------------------------EPVSSDSLSTKDFAAV 206

  Fly   217 TSSGMSTPRVSPKHQQSGKEVAATTTGIPSAASSAQSSGVGSMVLQEPDVIASTKLAQSKTTDSI 281
            .....:.|   |:|                             :..|||::||||..........
Human   207 EEVAPAKP---PRH-----------------------------LTPEPDIVASTKKPVPARPPPP 239

  Fly   282 TSSGP--------VAPPRRKKKSRNCSISSSDQYSLPPADNEDTDSDTRSVKSVQGLQQKLRDDF 338
            |:..|        .|||.||:||.                                         
Human   240 TNFPPPRPPPPSRPAPPPRKRKSE----------------------------------------- 263

  Fly   339 VMEFES-SLNNATSSASNITLTCSSTNTVVSASASTSAASSSLPSTIAIHMRPMVASVTIAGPKL 402
             :|||: ...:......|||                   |.||                     |
Human   264 -LEFETLKTPDIDVPKENIT-------------------SDSL---------------------L 287

  Fly   403 TQSLGSSSTSVHSKPSPSNSAKSNSAPARVSSIDPNQGLNLFKAIQGGYVVKPRDEASNKAQGPS 467
            |.|:.|.||...|:||                      |:|..|..|                  
Human   288 TASMASESTVKDSQPS----------------------LDLASATSG------------------ 312

  Fly   468 QDEIERIEKMLMESANRPKLAGTGSNSLGSSTRYPGFYRGVNDKERRKSAGDEDVLKQMNIYVRT 532
             |:|                                    |..:|..|:...:.|..::....|.
Human   313 -DKI------------------------------------VTAQENGKAPDGQTVAGEVMGPQRP 340

  Fly   533 RTSSGKQLTDFEILEQVPVKNLDTGENMPLSEMRSPPVPEGWNPLSLHILKLTSHLEVIQKESDE 597
            |::||::|||.|||..|.:|||||||.:||| :....:|.|.|||:|||::.|.  |.:..::  
Human   341 RSNSGRELTDEEILASVMIKNLDTGEEIPLS-LAEEKLPTGINPLTLHIMRRTK--EYVSNDA-- 400

  Fly   598 ESVIGIPPSIEGQQPDEEELETE----DGSRLKKKTARIKRFFGSTMR-----------KTVDKA 647
                       .|..|||:|:::    ||.|||:||.::|:|.|.:::           :.::|.
Human   401 -----------AQSDDEEKLQSQPTDTDGGRLKQKTTQLKKFLGKSVKRAKHLAEEYGERAINKV 454

  Fly   648 KSIASEVSHARHKEDVADIVDAMNPEQNIKIKASSSNKGPYEFTKLQHVQDLSGEDTSAVWCMKF 712
            ||:..||.|....:..:...:.|...:.:|.||:...||||:|.:::.|||||||...|||.|||
Human   455 KSVRDEVFHTDQDDPSSSDDEGMPYTRPVKFKAAHGFKGPYDFDQIKVVQDLSGEHMGAVWTMKF 519

  Fly   713 SSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRNKYNADQKSSPTPSQESLVSQHSAEEAIAMATA 777
            |.||||||:||||.|:|||.||:|:.:|.:||.|||.:.:.||:||||||.|..|       .|.
Human   520 SHCGRLLASAGQDNVVRIWALKNAFDYFNNMRMKYNTEGRVSPSPSQESLSSSKS-------DTD 577

  Fly   778 AEKCTG----------PFMPKPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLC 832
            ...|:|          ||..:|||.|.|||:||||:|||||||:||||||||||||||||:||||
Human   578 TGVCSGTDEDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVRLWHISRRECLC 642

  Fly   833 CFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFA 897
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||::|
Human   643 CFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGKYA 707

  Fly   898 VVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPMPGEDKILVTSNDSRVRLYDLR 962
            |:|:||||||||:|:.||||||||||||||:|::||||:||||:|||:||||||||||:||||||
Human   708 VIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLR 772

  Fly   963 DLNLSCKYKGYLNVSSQIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIK 1027
            ||:||.|||||:|.|||||.|||||..|:::|||::.:|||.|.||.||.:||||||:|||||||
Human   773 DLSLSMKYKGYVNSSSQIKASFSHDFTYLVSGSEDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIK 837

  Fly  1028 AHNATVTCAIFAPHPEAII-------KPEPDEISNE-KLAHNQPDPLVEQHKKGCGYVLVSADFN 1084
            ||||.||.|||||:|..::       |.|.:|.|.: ::....|..::   |.....||:||||.
Human   838 AHNAVVTSAIFAPNPSLMLSLDVQSEKSEGNEKSEDAEVLDATPSGIM---KTDNTEVLLSADFT 899

  Fly  1085 GAIKVFINKTK 1095
            ||||||:||.|
Human   900 GAIKVFVNKRK 910

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 13/37 (35%)
WD40 704..1101 CDD:225201 277/411 (67%)
WD40 704..1046 CDD:295369 256/352 (73%)
WD40 repeat 707..765 CDD:293791 38/58 (66%)
WD40 repeat 800..834 CDD:293791 31/34 (91%)
WD40 repeat 841..878 CDD:293791 37/37 (100%)
WD40 repeat 885..920 CDD:293791 28/35 (80%)
WD40 repeat 935..975 CDD:293791 33/40 (83%)
WD40 repeat 978..1003 CDD:293791 15/25 (60%)
WD40 repeat 1034..1069 CDD:293791 12/43 (28%)
WDR44NP_061918.3 Binding activity 2..170 36/180 (20%)
WD 1 509..548 26/39 (67%)
WD40 510..857 CDD:238121 256/354 (72%)
WD40 repeat 514..562 CDD:293791 30/48 (63%)
WD 2 605..643 34/38 (89%)
WD40 repeat 610..644 CDD:293791 31/34 (91%)
WD 3 645..685 40/40 (100%)
WD40 repeat 651..688 CDD:293791 37/37 (100%)
WD 4 690..729 32/39 (82%)
WD40 repeat 695..730 CDD:293791 28/35 (80%)
WD 5 740..779 31/39 (79%)
WD40 repeat 745..785 CDD:293791 33/40 (83%)
WD 6 784..823 23/39 (59%)
WD40 repeat 789..813 CDD:293791 14/24 (58%)
WD 7 876..913 17/39 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330114266
eggNOG 1 0.900 E1_KOG0283
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 674 1.000 Inparanoid score I716
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T1073209
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14221
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1821
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.890

Return to query results.
Submit another query.