DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and SPAC3H5.08c

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_594184.2 Gene:SPAC3H5.08c PomBaseID:SPAC3H5.08c Length:933 Species:Schizosaccharomyces pombe

Alignment Length:810 Identity:250/811 (31%)
Similarity:359/811 (44%) Gaps:231/811 (28%)


  Fly   395 VTIAGPK-----LTQSLGSSSTSVHSKPSPSNSAK------SNSAPARVSSIDPNQGLNLFKAIQ 448
            :.|..||     |.....::....|.||.....|.      |:|..:|..|.|.|          
pombe     8 IQIQSPKNSLDHLNNGRQATHNFEHGKPGDREEANGHADAHSSSGRSRYLSSDTN---------- 62

  Fly   449 GGYVVKPRDEASNKAQGPSQDEIERIEKMLMESANRPKLAGTGSNSLGSSTRYPGFYRGVNDKER 513
                 ..||.:|:         ::.:.|.:|:.....|.....:.|..||..:            
pombe    63 -----LLRDGSSS---------LDPLSKHIMKRTRSEKTLSFLNPSRASSNTH------------ 101

  Fly   514 RKSAGDEDVLKQMNIYVRTRTSSGKQLTDFEILEQVPVKNLDTGENMPLS-----EMRSPPVPEG 573
               ...|...:..|:   |||.||::......|       .||||:..||     .:|.|  .:.
pombe   102 ---LSREGTNRSSNV---TRTVSGRKSNHGSSL-------TDTGESDQLSLKSFGAIRQP--SQH 151

  Fly   574 WNPLSLHILKLTSHL----EVIQKESDEESVIGIPPSIEGQQPDEEELETEDGSRL--------- 625
            .:.|...:|..|||:    |.:..||.||...|| |.:||...|.... ..||..:         
pombe   152 RSSLFSRMLGSTSHIFGIREDMDNESSEEERDGI-PRVEGNAADPFSW-IPDGKNVWDSPPKYIR 214

  Fly   626 ----KKKTARIKRFF-------GSTMRKTVDK-----------AKSIASEVSHARHKEDVADIVD 668
                .||...:...|       ..|:..|.|:           ....:||.|.:||..|...|.:
pombe   215 VLSHNKKEKSLDHLFLAQELYCKPTLAATHDRYYEPRATDFPNLAHESSEPSSSRHTADAQSITN 279

  Fly   669 AMNPEQNIKIKASSS--NKGPYEFTKLQHV----QDLSGEDTSAVWCMKFSSCGRLLATAGQDKV 727
            |     ::.:..|||  |:.|...:....|    ...|....:|:|.||||..||.||..|||::
pombe   280 A-----SVHLHNSSSPLNRTPSVISDTLAVAITSNSSSNSSNNAIWAMKFSRDGRYLAVGGQDRI 339

  Fly   728 LRIWVLKDAYPFFQDMRNKYNADQKSSPTPSQESLVSQHSAEEAIAMATAAEKCTG-PFMPK--- 788
            ||||.:.|                            |:|      |.:.|:|.|:. |..||   
pombe   340 LRIWAVLD----------------------------SEH------ARSVASETCSSDPNNPKLNL 370

  Fly   789 --------PFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVTAIAF 845
                    |...|.|||:|:||:|||:|.|:||||||||.||||..||:|||||:|.||||:|||
pombe   371 KAPVFSEAPIREYAGHTADILDLSWSRNNFLLSSSMDKTARLWHPVRKDCLCCFEHSDFVTSIAF 435

  Fly   846 HPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYN 910
            ||:|||:|||||||.|||||:|.:|.|:.|||:   .:||||..|..:|..|:.|::.|.|:||:
pombe   436 HPKDDRFFLSGSLDCKLRLWSIKEKAVSFWNEL---PELITAVAFSPDGGLAIAGTFVGLCLFYD 497

  Fly   911 TDQLKYHTQIHVRSTRGKNRIGRKISGIEP-------MPGEDKILVTSNDSRVRLYDLRDLNLSC 968
            |..|::.||:.:||:||||..|.|::||:.       :.|:.::|||:||||:|:|:|||.:|..
pombe   498 TRGLRFRTQMSIRSSRGKNAKGSKVTGIQTRTQMIDNIAGDTEMLVTTNDSRIRIYNLRDKSLEL 562

  Fly   969 KYKGYLNVSSQIKGSFSHDGKYIIAGSENQCIYIW-----------KTNHDYSKLSSVRRDRSDF 1022
            |:||:.|..||.:..|..||.|:|.|||:..::||           |..|::.| :|||      
pombe   563 KFKGHANAQSQNRAYFDDDGNYVICGSEDHQVFIWDLPPQHMHKTKKKKHEHFK-ASVR------ 620

  Fly  1023 WEGIKAHNATVTCAIFAP--------------HPEAIIKPEPDEISN------------EKLAHN 1061
                     .:|.|:|||              :..||.......|||            :.|:|:
pombe   621 ---------PITAAVFAPTKTKQLLTLSGDPVYLAAISARRSSVISNASIETGPSLRNLKSLSHS 676

  Fly  1062 Q-PDPLVEQHKKGCGYVLVSADFNGAIKVF 1090
            . |..:::      |:::|..|.:|.|:||
pombe   677 YLPIEIMK------GHIIVCGDLDGRIRVF 700

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 8/43 (19%)
WD40 704..1101 CDD:225201 172/445 (39%)
WD40 704..1046 CDD:295369 159/386 (41%)
WD40 repeat 707..765 CDD:293791 18/58 (31%)
WD40 repeat 800..834 CDD:293791 25/34 (74%)
WD40 repeat 841..878 CDD:293791 27/37 (73%)
WD40 repeat 885..920 CDD:293791 15/35 (43%)
WD40 repeat 935..975 CDD:293791 19/47 (40%)
WD40 repeat 978..1003 CDD:293791 11/25 (44%)
WD40 repeat 1034..1069 CDD:293791 13/62 (21%)
SPAC3H5.08cNP_594184.2 WD40 319..>600 CDD:225201 145/318 (46%)
WD40 319..598 CDD:295369 145/316 (46%)
WD40 repeat 319..349 CDD:293791 18/58 (31%)
WD40 repeat 390..425 CDD:293791 26/35 (74%)
WD40 repeat 431..467 CDD:293791 26/36 (72%)
WD40 repeat 472..507 CDD:293791 15/35 (43%)
WD40 repeat 522..569 CDD:293791 19/47 (40%)
WD40 repeat 655..707 CDD:293791 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T1124799
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14221
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1821
TreeFam 1 0.960
77.000

Return to query results.
Submit another query.