DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and SPBC18H10.05

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_595729.1 Gene:SPBC18H10.05 PomBaseID:SPBC18H10.05 Length:586 Species:Schizosaccharomyces pombe

Alignment Length:613 Identity:165/614 (27%)
Similarity:261/614 (43%) Gaps:151/614 (25%)


  Fly   518 GDEDVLKQMNIYVRTR------TSSG------KQLTDFEILEQVPVKNLDTGENMPLSEMRSPPV 570
            |.||     |:.|.:|      :.||      |..||.|.....||:.|.|         ||...
pombe     9 GRED-----NVSVHSREVSVNGSDSGTGNDAYKLETDDEHPPATPVRGLST---------RSQKR 59

  Fly   571 PEGWNPLSLHILKLTSHLEVIQKESDEE--------------SVIGIPPS----IEGQQPDEEEL 617
            |  :.||:            ||::.|.|              |::..|..    .|...|:.|:|
pombe    60 P--FRPLT------------IQQDEDVENDTGMNTEYNDDNSSLVNTPRDSTTYAETNSPNTEKL 110

  Fly   618 ETEDGSRLKKKTARIKRFFGSTMRKTVDKAKSIASEVSHARHKEDVADIVDAMNPEQNIKIKAS- 681
            ...|..|              ::...:|:     .|:...|.:..|......| |::.|.:... 
pombe   111 AGRDDDR--------------SLLNLIDR-----GEIDSKRQRHYVPVHCKRM-PKKEITLNQKL 155

  Fly   682 --SSNKGPYEFTKLQHV------QDLSGEDTSAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYP 738
              |...||.:..|.:.:      |....:...:||..:.|..|:.|||||:|.::|:|       
pombe   156 YVSQVIGPADAPKSKTIFGKRIMQWEPSQFKESVWASEISKSGKYLATAGKDAIIRVW------- 213

  Fly   739 FFQDMRNKYNADQKSSPTPS-QESLVSQHSAEEAIAMATAAEKC------TGPFMPKPFCTYNGH 796
                         |...||. :|:|:.:           ..:.|      :..|.|:|.....||
pombe   214 -------------KVIETPERRETLLKE-----------GPQSCGRFFTPSSIFEPEPVLECVGH 254

  Fly   797 TSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGK 861
            .:::|.:|||||.|:|:||.|:||||||....:.|..|:|.:.||.:||||.|||||:|||||.|
pombe   255 NAEVLSISWSKNDFLLTSSADRTVRLWHPKSTKSLAVFRHNEIVTCVAFHPIDDRYFVSGSLDCK 319

  Fly   862 LRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCIFYNTDQLKYHTQ--IHVRS 924
            ::||:|...|:..|.|::   .:::...|..:|:..|||.:.|.|..|.|..|:|.:.  ||...
pombe   320 IQLWSILRHKILHWTELE---YVVSTICFYPDGESIVVGMFYGLCAIYETKNLQYVSSWLIHHSP 381

  Fly   925 TRGKNRIGRKISGIE---PMPGEDK----ILVTSNDSRVRLYDLRDLNLSCKYKGYLNVSSQIKG 982
            :|.|.   .:::|::   .:|.:.|    :||::||:.:|||:.....|..|......|:.::..
pombe   382 SRNKK---CRVTGLQCASIIPNDSKSDNVVLVSTNDNAIRLYNTVTHALVLKLSDAHRVNGRVLS 443

  Fly   983 SFSHDGKYIIAGSENQCIYIWKTNHDYSK-LSSVRRDRSDF----WEGIKAHNATVTCAIFAPHP 1042
            ..|.|..|||:||:...:.:|   |..:| |.:..|.||..    .|..|..:..:|..|.||..
pombe   444 RLSEDNSYIISGSDTNEVVLW---HIPNKVLINASRKRSVILHLPTETFKVCSERLTSTIIAPAR 505

  Fly  1043 EAIIKPEPDEISNEKLAHNQPDPLVEQH 1070
            .|:   |..|..:::....:...||:.|
pombe   506 TAV---EAKESEHDRSLIAEGYNLVKPH 530

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 9/46 (20%)
WD40 704..1101 CDD:225201 120/389 (31%)
WD40 704..1046 CDD:295369 115/363 (32%)
WD40 repeat 707..765 CDD:293791 17/59 (29%)
WD40 repeat 800..834 CDD:293791 18/34 (53%)
WD40 repeat 841..878 CDD:293791 22/37 (59%)
WD40 repeat 885..920 CDD:293791 11/37 (30%)
WD40 repeat 935..975 CDD:293791 12/47 (26%)
WD40 repeat 978..1003 CDD:293791 7/25 (28%)
WD40 repeat 1034..1069 CDD:293791 9/35 (26%)
SPBC18H10.05NP_595729.1 WD40 143..519 CDD:225201 125/420 (30%)
WD40 188..464 CDD:295369 101/313 (32%)
WD40 repeat 189..253 CDD:293791 21/95 (22%)
WD40 repeat 259..293 CDD:293791 19/34 (56%)
WD40 repeat 298..327 CDD:293791 20/29 (69%)
WD40 repeat 341..376 CDD:293791 11/35 (31%)
WD40 repeat 389..433 CDD:293791 12/44 (27%)
WD40 repeat 441..483 CDD:293791 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14221
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.