DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and Wdr44

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_006257504.1 Gene:Wdr44 RGDID:727965 Length:919 Species:Rattus norvegicus

Alignment Length:1173 Identity:443/1174 (38%)
Similarity:577/1174 (49%) Gaps:338/1174 (29%)


  Fly     4 LETDSDSSEEFFDAEDTTPNRHSTLCRKLPPEVAQEFIFPEPAVRVNAAASSDSDATPIGAGTPA 68
            :.::|| :|||:||                         ||.   |:...|     .|:|:    
  Rat     1 MASESD-TEEFYDA-------------------------PED---VHLGGS-----YPVGS---- 27

  Fly    69 TRSPTNSLGARLKPQDAGV--FVEPKPVIGPLGRQR-FHELRQCMQND------EDDNPGNTLTP 124
                         |...|:  |.|.|......|.:. ..||||.:...      |:......|..
  Rat    28 -------------PGKVGLLSFKETKNTGNKAGNESPVQELRQDVSKKIIECIIEESQKVLQLED 79

  Fly   125 DSQNSSTDGIFTNRSTHPFKVIETDAMSIQSMTSLGRVGRILAGSIDPSAISIDRESLASLNAQQ 189
            ||.:|...|: ::::|....|..|:..:|                  |..::|..|      .||
  Rat    80 DSLDSKGKGL-SDQATASHSVAGTEFSNI------------------PGLLAIQHE------LQQ 119

  Fly   190 QKQQAQQQQQAQPTSSTSSNTPPSVGNTSSGMST-------PRVSPKHQQS---------GKEVA 238
            ..::|..|..|:.|...:....||..|......|       ..||...|..         .||..
  Rat   120 GSRKADSQNAAEETELETQKCFPSDNNCEKSEKTEDETNNLTEVSSADQLDASKLETEILNKEAV 184

  Fly   239 ATTTG--IPSAASSAQSSGVGSMVLQ------------EPDVIASTKLAQSKTTDSITSSGP--- 286
            ....|  :..|:|.|.|:...:.|.:            |||::||||..........|:..|   
  Rat   185 EVKEGDVVNPASSDALSTKDFAAVEEVAPAKPPRHLTPEPDIVASTKKPVPARPPPPTNFPPPRP 249

  Fly   287 -----VAPPRRKKKSRNCSISSSDQYSLPPADNEDTDSDTRSVKSVQGLQQKLRDDFVMEFES-S 345
                 .|||.|||||.                                          :|||: .
  Rat   250 PPPSRPAPPPRKKKSD------------------------------------------LEFEALK 272

  Fly   346 LNNATSSASNITLTCSSTNTVVSASASTSAASSSLPSTIAIHMRPMVASVTIAGPKLTQSLGSSS 410
            ..:......||                   ||.||                     ||.::.|.|
  Rat   273 TPDLDVPKDNI-------------------ASDSL---------------------LTTNMASES 297

  Fly   411 TSVHSKPSPSNSAKSNSAPARVSSIDPNQGLNLFKAIQGGYVVKPRDEASNKAQGPSQDEIERIE 475
            |...|.||                      |:|..|..|..:|..:                   
  Rat   298 TVRDSLPS----------------------LDLASATSGDKIVTAQ------------------- 321

  Fly   476 KMLMESANRPKLAGTGSNSLGSSTRYPGFYRGVNDKERRKSAGDEDVLKQMNIYVRTRTSSGKQL 540
                |:...|.:.......:|..                                |.|::||::|
  Rat   322 ----ENGKAPDVQTVAGEVMGPQ--------------------------------RPRSNSGREL 350

  Fly   541 TDFEILEQVPVKNLDTGENMPLSEMRSPPVPEGWNPLSLHILKLTSHLEVIQKESDEESVIGIPP 605
            ||.|||..|.:|||||||.:||| :....:|.|.|||:|||::.|.  |.::.|...::.     
  Rat   351 TDEEILASVMIKNLDTGEEIPLS-LAEEKLPTGINPLTLHIMRRTK--EYVRYELSNDAT----- 407

  Fly   606 SIEGQQPDEEELETE----DGSRLKKKTARIKRFFGSTMR-----------KTVDKAKSIASEVS 655
                |..|||:|:::    ||.|||:||.::|:|.|.:::           :.::|.||:..||.
  Rat   408 ----QSDDEEKLQSQQTDTDGGRLKQKTTQLKKFLGKSVKRAKHLAEEYGERAINKVKSVRDEVF 468

  Fly   656 HARHKEDVADIVDAMNPEQNIKIKASSSNKGPYEFTKLQHVQDLSGEDTSAVWCMKFSSCGRLLA 720
            |....:..:...:.|...:.:|.||:...||||:|.:::.|||||||...|||.||||.||||||
  Rat   469 HTDQDDPSSSDDEGMPYTRPVKFKAAHGFKGPYDFDQIKVVQDLSGEHMGAVWTMKFSHCGRLLA 533

  Fly   721 TAGQDKVLRIWVLKDAYPFFQDMRNKYNADQKSSPTPSQESLVSQHSAEEAIAMATAAEKCTG-- 783
            :||||.::|||.||:|:.:|.:||.|||.:.:.||:||||||.|..|       .|....|:|  
  Rat   534 SAGQDNIVRIWALKNAFDYFNNMRMKYNTEGRVSPSPSQESLSSSKS-------DTDMGVCSGTD 591

  Fly   784 --------PFMPKPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFV 840
                    ||..:|||.|.|||:||||:|||||||:||||||||||||||||:||||||||||||
  Rat   592 EDPDDKNAPFRQRPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVRLWHISRRECLCCFQHIDFV 656

  Fly   841 TAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDGR 905
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||::||:|:||||
  Rat   657 TAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGKYAVIGTYDGR 721

  Fly   906 CIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKY 970
            ||||:|:.||||||||||||||:|::||||:||||:|||:||||||||||:||||||||:||.||
  Rat   722 CIFYDTEHLKYHTQIHVRSTRGRNKVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKY 786

  Fly   971 KGYLNVSSQIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTC 1035
            |||:|.|||||.|||||..|:::|||::.:|||.|.||.||.:||||||:|||||||||||.||.
  Rat   787 KGYVNSSSQIKASFSHDFTYLVSGSEDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIKAHNAVVTS 851

  Fly  1036 AIFAPHPEAIIKPEP--------DEISNEKLAHNQPDPLVEQHKKGCGYVLVSADFNGAIKVFIN 1092
            |||||:|..::..:.        |:..:.::..|....:|   |.....||:||||.||||||||
  Rat   852 AIFAPNPSLMLSLDVQSEKLEGIDKYEDAEVLDNTSTGIV---KTDNTEVLLSADFTGAIKVFIN 913

  Fly  1093 KTK 1095
            |.|
  Rat   914 KRK 916

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 13/37 (35%)
WD40 704..1101 CDD:225201 275/411 (67%)
WD40 704..1046 CDD:295369 255/352 (72%)
WD40 repeat 707..765 CDD:293791 37/58 (64%)
WD40 repeat 800..834 CDD:293791 31/34 (91%)
WD40 repeat 841..878 CDD:293791 37/37 (100%)
WD40 repeat 885..920 CDD:293791 28/35 (80%)
WD40 repeat 935..975 CDD:293791 33/40 (83%)
WD40 repeat 978..1003 CDD:293791 15/25 (60%)
WD40 repeat 1034..1069 CDD:293791 10/43 (23%)
Wdr44XP_006257504.1 WD40 503..>829 CDD:225201 238/333 (71%)
WD40 516..863 CDD:295369 255/354 (72%)
WD40 repeat 520..611 CDD:293791 47/98 (48%)
WD40 repeat 617..651 CDD:293791 31/34 (91%)
WD40 repeat 656..692 CDD:293791 36/36 (100%)
WD40 repeat 702..735 CDD:293791 26/33 (79%)
WD40 repeat 751..787 CDD:293791 30/36 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C330111056
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 650 1.000 Inparanoid score I741
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T1086851
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14221
Phylome 1 0.910 0.667 Consistency score
TreeFam 00.000 Not matched by this tool.
88.000

Return to query results.
Submit another query.