DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and sym-4

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:NP_510361.1 Gene:sym-4 WormBaseID:WBGene00006369 Length:1043 Species:Caenorhabditis elegans

Alignment Length:1075 Identity:344/1076 (32%)
Similarity:518/1076 (48%) Gaps:237/1076 (22%)


  Fly   179 RESLASLNAQQQKQQAQQQQQAQPTSST--SSNTPPSVGNTSSGMSTPRVSPKHQQSGKEVAATT 241
            |..:.:..|....:.|.::.:...||||  ||::.|    .|:..:||.:|             :
 Worm    43 RPEVLNFAAPSATRLAMRRSEQPVTSSTPFSSSSRP----MSAVFNTPSLS-------------S 90

  Fly   242 TGIPSAASSA----------------QSSGVGSMVLQEPDVIASTKLAQSKTTDSITSSGPVAPP 290
            :|.|:.::|:                .:...|:..|..|  .|.|.....:|..:::.:..:...
 Worm    91 SGFPATSTSSIRDSSHRDRLISLRHRMNKEFGNRQLVGP--TAQTDYEHDETMSTVSDAPSLHSW 153

  Fly   291 RRKK--KSRNCSISSSDQYSLPPADNEDTDSDTRSVKSVQGLQQKLRDDFVMEFESSLNNATSSA 353
            ..|.  |:....::::|..|...|...:                       |.||:||.:.::::
 Worm   154 HHKMIVKNETVIVNATDTLSSCAAPRSE-----------------------MGFENSLISQSNTS 195

  Fly   354 SNITLT-------------CSSTNTVVSASASTSAASSSLPSTIAIH------------------ 387
            :|.|:|             .|||.|...:|.|..:.|:.:|..|...                  
 Worm   196 ANATITPMKVNIPIDESRHRSSTWTPTDSSCSGISPSTRVPPPIPSRAPVMSPVQSPLTHPPVAP 260

  Fly   388 -------MRPMVASVTIAGP---------------KLTQ---SLGSSSTSVHSKPSPSNSAKSNS 427
                   :.|...|:.:..|               .|.|   |:|||.:|.....|.:...|..:
 Worm   261 MPRCPPPLPPRTPSMKLPDPIAFEVENRIEEERKKNLIQREISVGSSKSSDALMASTTPDVKEVN 325

  Fly   428 APARVSSIDPNQGLNLFKAIQ-----------GGYVVKPRDEASNKA-------------QGPSQ 468
            ...:.:|||  :||.:.||::           ||......:|..|..             ...:.
 Worm   326 GHRKSNSID--RGLTIAKAMKTGPFPPNALALGGREATGEEEERNVVAEEVIRQITTDVETAHNL 388

  Fly   469 DEIERIEKMLMESANRPKLAGTGSNSLGSSTRYPGFYRGVNDKERRKSAGDEDVLKQMNIYV--- 530
            .:.:.::.|.:|:      ..:.|||..||                .|:..|...||:.|.:   
 Worm   389 SDCQNVDTMSLET------IPSASNSTASS----------------PSSASEAECKQIAIRIPDP 431

  Fly   531 --RTRTSSGKQLTDFEILEQV----PVKNLDTGENMPLS--EMR---SPPVPEGWNPLSLHILKL 584
              ....||.|   .|..||.|    |.|.:....:..||  |:|   |..:....:|::|.:.:.
 Worm   432 IPEEAPSSSK---SFGALESVNSLSPAKTVTNRNSRSLSNDELRTNKSDKLSSSVDPITLDVERR 493

  Fly   585 TSHLEVIQKESDEESVIGIPPSIEGQQPDEEELETEDGSRLKKKTARIKRFFGSTMRKTVDKAKS 649
            .|.....|.|||..|:..:..:...:......:|:  .:...:.:.|    :.|.|.:...|...
 Worm   494 LSMKRSGQHESDRHSIGSLDETTSNRTLSRTGIES--AASFARNSVR----YASGMLRGAFKRVR 552

  Fly   650 IASEVSHA---RH--KEDVADIVDAMNPE------QNIKIKASSSNKGPYEFTKLQHVQDLSGED 703
            ||:....:   ||  .|:.:|..::..|.      .|| ::...|.||||:|..|...|:|:.|.
 Worm   553 IAAHPGSSSLNRHGIGEETSDGEESDEPHHPSVAPSNI-VRPRKSKKGPYDFEHLTVEQELNNEH 616

  Fly   704 TSAVWCMKFSSCGRLLATAGQDKVLRIWVLKDAYPFFQDMRNKY--NADQKSSPTPSQESLVSQH 766
            |.|:||:|||.||:|:||||||.:||:||::....:|.|||.||  ||:.::.|..|.:::  :|
 Worm   617 TGAIWCIKFSICGKLMATAGQDSILRVWVVRSHLQYFSDMREKYAANANPEADPMNSVDNM--EH 679

  Fly   767 ----SAEEAIA---MATAAEKCTGPFMPKPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWH 824
                |:.|::.   ..||::...|.|..|||....|||:|:||||||||||||||.||:||:|||
 Worm   680 FRPPSSMESVVNSEATTASDDNNGLFCAKPFALLKGHTADILDVSWSKNYFILSSGMDRTVKLWH 744

  Fly   825 ISRKECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAAN 889
            :||.|||||||||||||.:||.|:|||||||||||||||:|:|||||||:||  |.:.|.|||..
 Worm   745 LSRNECLCCFQHIDFVTCVAFLPKDDRYFLSGSLDGKLRMWHIPDKKVAVWN--DTEKKYITAMT 807

  Fly   890 FCQNGQFAVVGSYDGRCIFYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPMPGEDKILVTSNDS 954
            |.::|:|||||:|||:||||.:|||||||.:.||||||||..|.|::|:  ....||:|||||||
 Worm   808 FVKSGKFAVVGTYDGKCIFYTSDQLKYHTAVDVRSTRGKNARGHKVTGL--TSHGDKLLVTSNDS 870

  Fly   955 RVRLYDLRDLNLSCKYKGYLNVSSQIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDR 1019
            |:|:||:||..|:||:||..|..|||:.:||.||::||.|||::.:|||:.: |.:...|||:||
 Worm   871 RIRMYDIRDKALTCKFKGVQNDHSQIRAAFSPDGRHIICGSEDKFVYIWRAS-DTTVALSVRKDR 934

  Fly  1020 SDFWEGIKAHNATVTCAIFAPHPEAIIK--------PEPDEIS---NEKLAHNQPDPLVEQHKKG 1073
            :.:||.::.|||.|..|:|||.|:....        .:.|.|.   :.::...|.|.|.......
 Worm   935 NSWWERVRTHNAPVPVAVFAPRPQVFFNMLNKRDKHSKSDSIDFNISGQVLPGQSDSLTSNGNLS 999

  Fly  1074 C-GYVLVSADFNGAIKVFINKTK--------PKHS 1099
            . |:|::|||.||.|||.||:.:        ||:|
 Worm  1000 IPGHVIISADLNGVIKVMINRPRLVKANPLDPKNS 1034

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 13/43 (30%)
WD40 704..1101 CDD:225201 218/426 (51%)
WD40 704..1046 CDD:295369 198/351 (56%)
WD40 repeat 707..765 CDD:293791 28/60 (47%)
WD40 repeat 800..834 CDD:293791 28/34 (82%)
WD40 repeat 841..878 CDD:293791 29/37 (78%)
WD40 repeat 885..920 CDD:293791 24/35 (69%)
WD40 repeat 935..975 CDD:293791 21/40 (53%)
WD40 repeat 978..1003 CDD:293791 14/25 (56%)
WD40 repeat 1034..1069 CDD:293791 10/46 (22%)
sym-4NP_510361.1 WD40 repeat 760..796 CDD:293791 29/36 (81%)
WD40 repeat 804..843 CDD:293791 26/39 (67%)
WD40 repeat 850..887 CDD:293791 21/39 (54%)
WD40 603..>919 CDD:225201 185/322 (57%)
WD40 614..920 CDD:295369 182/312 (58%)
WD40 repeat 620..654 CDD:293791 19/34 (56%)
WD40 repeat 721..755 CDD:293791 29/34 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C329701289
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 454 1.000 Inparanoid score I887
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T475176
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14221
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1821
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.