DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG34133 and wdr44

Sequence 1:NP_001036772.2 Gene:CG34133 FlyBaseID:FBgn0083969 Length:1108 Species:Drosophila melanogaster
Sequence 2:XP_002939709.1 Gene:wdr44 XenbaseID:XB-GENE-1007867 Length:912 Species:Xenopus tropicalis

Alignment Length:1168 Identity:448/1169 (38%)
Similarity:581/1169 (50%) Gaps:335/1169 (29%)


  Fly     4 LETDSDSSEEFFDAEDTTPNRHSTLCR-KLPPEVAQEFIFPEPAVRVNAAASSDSDATPIGAGTP 67
            :.:||| :||||||    |...:..|. .:.|..::.||..|....     |.:::...|.....
 Frog     1 MASDSD-TEEFFDA----PEDVNLSCSPAVSPTKSETFILKEEVTH-----SRNAETRNIDLKQD 55

  Fly    68 ATRSPTNSLGARLK----PQDAGVFVEPKPVIGPLGRQRFHELRQCMQNDEDDNPGNTLTPDSQN 128
            .::...:|:....:    .::|...||.||.|       .||               |||.::..
 Frog    56 DSKEIIDSIIEESQKYSDTENAHPVVEEKPEI-------LHE---------------TLTAETSK 98

  Fly   129 SS------------TDGIFTNRSTHPFKV-----IETDAMSIQSMTSLGRVGRILAG-SIDPSAI 175
            :|            |:..|.:....|.:.     :|.|....|.           || |.|||.:
 Frog    99 TSQDLLSNIPELVVTESTFHDGVDDPVQQQIGEHVEPDNSRTQK-----------AGPSADPSYV 152

  Fly   176 SIDRESLASLN-----------AQQQKQQAQQQQQAQPTSSTSSNTPPSVGNTSSGMSTPRVSPK 229
            |...|::..|.           .::.:....|::...|:.....:..|::..:......|...|.
 Frog   153 SSAIENIVDLTQDLKIIEDLKIEEEPEISLIQEENKDPSKHIVEDVLPNIPTSDILEQLPPAKPP 217

  Fly   230 HQQSGKEVAATTTGIPSAASSAQSSGVGSMVLQEPDVIASTKLAQSKTTDSITSSGPV------- 287
            .|                            :..|||::||||           ..||.       
 Frog   218 RQ----------------------------ICVEPDIVASTK-----------KPGPTRPPLPIN 243

  Fly   288 ------------APPRRKKKSRNCSISSSDQYSLPPADNEDTDSDTRSVKSVQGLQQKLRDDFVM 340
                        |||.|||||                   |||.|..|     |.:.: :|.|  
 Frog   244 VPPPRPPPPARPAPPPRKKKS-------------------DTDFDRSS-----GFEYQ-KDGF-- 281

  Fly   341 EFESSLNNATSSASNITLTCSSTNTVVSASASTSAASSSLPSTIAIHMRPMVASVTIAGPKLTQS 405
                 |.....|                            |:|                  ||::
 Frog   282 -----LGGGLLS----------------------------PNT------------------LTEN 295

  Fly   406 LGSSSTSVHSKPSPSNSAKSNSAPARVSSIDPNQGLNLFKAIQGGYVVKPRDEASNKAQGPSQDE 470
            :...     |:||                      |:|..|..|..||..::   |......|..
 Frog   296 MNRD-----SQPS----------------------LDLASATSGEKVVTAQE---NGKAADGQLS 330

  Fly   471 IERIEKMLMESANRPKLAGTGSNSLGSSTRYPGFYRGVNDKERRKSAGDEDVLKQMNIYVRTRTS 535
            .:.||                  |||..                                |.|::
 Frog   331 CQAIE------------------SLGPQ--------------------------------RPRSN 345

  Fly   536 SGKQLTDFEILEQVPVKNLDTGENMPLSEMRSPPVPEGWNPLSLHILKLTSHLEVIQK---ESDE 597
            ||::|||.|||..|.:|||||||.:||| :....:|.|.|||:|||::.|.  |.:..   :||:
 Frog   346 SGRELTDEEILASVMIKNLDTGEEIPLS-LAEEKLPTGINPLTLHIMRRTK--EYVSNDAAQSDD 407

  Fly   598 ESVIGIPPSIEGQQPDEEELETEDGSRLKKKTARIKRFFGSTMR-----------KTVDKAKSIA 651
            |           .:|...:.|| ||.:||:||.::|:|.|.:::           :.|:|.||:.
 Frog   408 E-----------DKPQPHQSET-DGGKLKQKTTQLKKFLGKSVKRAKHLAEEYGERAVNKVKSVR 460

  Fly   652 SEVSHARHKEDVADIVDAMNPEQNIKIKASSSNKGPYEFTKLQHVQDLSGEDTSAVWCMKFSSCG 716
            .||.|....:..:...:.|...:.:|.||:...||||:|.:::.|||||||...|||.||||.||
 Frog   461 DEVFHTDQDDPSSSDDEGMPYTRPVKFKAAHGFKGPYDFEQIKVVQDLSGEHVGAVWTMKFSHCG 525

  Fly   717 RLLATAGQDKVLRIWVLKDAYPFFQDMRNKYNADQKSSPTPSQESLVSQHS-AEEAIAMAT---A 777
            ||||:||||.|:||||||:|:.:|.:||.|||.:.:.||:||||||.|..| .:..:..||   .
 Frog   526 RLLASAGQDNVVRIWVLKNAFDYFNNMRIKYNTEGRVSPSPSQESLNSSKSDTDGGVYSATDDMD 590

  Fly   778 AEKCTGPFMPKPFCTYNGHTSDLLDVSWSKNYFILSSSMDKTVRLWHISRKECLCCFQHIDFVTA 842
            .:....||...|||.|.|||:||||:|||||||:||||||||||||||||:||||||||||||||
 Frog   591 PDDKNAPFRQVPFCKYKGHTADLLDLSWSKNYFLLSSSMDKTVRLWHISRRECLCCFQHIDFVTA 655

  Fly   843 IAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEVDGQTKLITAANFCQNGQFAVVGSYDGRCI 907
            |||||||||||||||||||||||||||||||||||:||||||||||||||||:.||:|:||||||
 Frog   656 IAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALWNEIDGQTKLITAANFCQNGKHAVIGTYDGRCI 720

  Fly   908 FYNTDQLKYHTQIHVRSTRGKNRIGRKISGIEPMPGEDKILVTSNDSRVRLYDLRDLNLSCKYKG 972
            ||:|:.||||||||||||||:||:||||:||||:|||:||||||||||:||||||||:||.||||
 Frog   721 FYDTEHLKYHTQIHVRSTRGRNRVGRKITGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKG 785

  Fly   973 YLNVSSQIKGSFSHDGKYIIAGSENQCIYIWKTNHDYSKLSSVRRDRSDFWEGIKAHNATVTCAI 1037
            .:|.|||||.|||||..||::|||::.:|||.|.||.||.:||||||:|||||||||||.||.||
 Frog   786 CVNSSSQIKASFSHDFTYIVSGSEDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIKAHNAVVTSAI 850

  Fly  1038 FAPHPEAIIKPEPDEISNEKLAHNQPDPLVEQHKKGC-----GYVLVSADFNGAIKVFINKTK 1095
            |||:|..::..   |.|:||...:|.:| ||....|.     ..||:||||.|||||||||.|
 Frog   851 FAPNPGLMVSA---ETSSEKQEGDQAEP-VENIPSGALKSDHTEVLLSADFTGAIKVFINKKK 909

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG34133NP_001036772.2 WD40 repeat 663..700 CDD:293791 13/37 (35%)
WD40 704..1101 CDD:225201 281/402 (70%)
WD40 704..1046 CDD:295369 256/346 (74%)
WD40 repeat 707..765 CDD:293791 39/58 (67%)
WD40 repeat 800..834 CDD:293791 31/34 (91%)
WD40 repeat 841..878 CDD:293791 37/37 (100%)
WD40 repeat 885..920 CDD:293791 28/35 (80%)
WD40 repeat 935..975 CDD:293791 32/40 (80%)
WD40 repeat 978..1003 CDD:293791 16/25 (64%)
WD40 repeat 1034..1069 CDD:293791 15/35 (43%)
wdr44XP_002939709.1 WD40 499..>826 CDD:225201 239/327 (73%)
WD40 512..863 CDD:295369 257/354 (73%)
WD40 repeat 516..556 CDD:293791 28/40 (70%)
WD40 repeat 613..647 CDD:293791 31/34 (91%)
WD40 repeat 654..691 CDD:293791 37/37 (100%)
WD40 repeat 698..733 CDD:293791 28/35 (80%)
WD40 repeat 748..788 CDD:293791 32/40 (80%)
WD40 repeat 792..816 CDD:293791 15/24 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0283
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 672 1.000 Inparanoid score I665
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1332590at2759
OrthoFinder 1 1.000 FOG0002807
OrthoInspector 1 1.000 T1059291
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1821
TreeFam 1 0.960
98.860

Return to query results.
Submit another query.