DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31008 and MIX17

Sequence 1:NP_733411.1 Gene:CG31008 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_013715.1 Gene:MIX17 SGDID:S000004604 Length:156 Species:Saccharomyces cerevisiae

Alignment Length:148 Identity:37/149 (25%)
Similarity:57/149 (38%) Gaps:44/149 (30%)


  Fly     2 PRKQRSASVKAGSTNYM----------PAVVPTVTNSEMVFKEAAAHAVGVAAGSVVGHAIGSGI 56
            |.:.||||..|...:..          |......|....:|.:.|:.|.|||.||.:||.:|:||
Yeast    16 PTQTRSASTMAAPVHPQQQQQPNAYSHPPAAGAQTRQPGMFAQMASTAAGVAVGSTIGHTLGAGI 80

  Fly    57 TGLF-----------------------RRRDQQPHHSDLVEEGPCAKEMKEFLKC-TEDNDDLSV 97
            ||:|                       .:.|||...:       |..:.:.|.:| .|:|.:..:
Yeast    81 TGMFSGSGSDSAPVEQQQQNMANTSGQTQTDQQLGRT-------CEIDARNFTRCLDENNGNFQI 138

  Fly    98 CKEFNDAVRRCH---RQY 112
            |..:...::.|.   |||
Yeast   139 CDYYLQQLKACQEAARQY 156

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 8/37 (22%)
MIX17NP_013715.1 DUF2076 <43..>99 CDD:331414 18/56 (32%)
CHCH 118..152 CDD:310983 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1582
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13523
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
55.010

Return to query results.
Submit another query.