DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and AT5G64400

DIOPT Version :10

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001032137.1 Gene:AT5G64400 / 836561 AraportID:AT5G64400 Length:162 Species:Arabidopsis thaliana


Alignment Length:38 Identity:11/38 - (28%)
Similarity:16/38 - (42%) Gaps:6/38 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRKQRSASVKAGSTNYMPAVVPTVTNSEMVFKEAAAHA 39
            ||..:..:|:|.|.:..||      .|.|:......||
plant    76 PRTIQHEAVEAASASAAPA------GSAMLSSTCDIHA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:429096
AT5G64400NP_001032137.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.