DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and Zbed5

DIOPT Version :8

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_898911.2 Gene:Zbed5 / 71970 MGIID:1919220 Length:756 Species:Mus musculus

Alignment Length:124 Identity:41/125 (33%)
Similarity:63/125 (50%) Gaps:20/125 (16%)


  Fly     2 PRKQRSA---SVKAGSTNYMPAVVPTVTNSEMVFKEAAAHAVGVAAGSVVGHAIGSGITGLF--- 60
            ||:..:|   :..|.|....||..|   ....:..:.|..|.|||.||.|||.:|..|||.|   
Mouse    26 PRRAPAAQPPAAAAPSAVGSPAAAP---RQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGG 87

  Fly    61 -----RRRD---QQPHHSDLVEE---GPCAKEMKEFLKCTEDNDDLSVCKEFNDAVRRC 108
                 .:.|   |:|..:.|..:   |||:.|:|:||:|.::..|:.:|:.||:.:|:|
Mouse    88 GSAEPAKPDITYQEPQGAQLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQC 146

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 12/32 (38%)
Zbed5NP_898911.2 CHCH 116..147 CDD:284221 12/32 (38%)
DUF4371 <335..407 CDD:290989
Dimer_Tnp_hAT 671..736 CDD:283379
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.