DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and CHCHD2

DIOPT Version :8

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001307256.1 Gene:CHCHD2 / 51142 HGNCID:21645 Length:168 Species:Homo sapiens

Alignment Length:144 Identity:40/145 (28%)
Similarity:63/145 (43%) Gaps:36/145 (25%)


  Fly     1 MPRKQRS----------------ASVKAGSTNYMPAVVP--TVTNSEM------VFKEAAAHAVG 41
            |||..||                |:.:.......||..|  .|.:|..      :..:.|..|.|
Human     1 MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAG 65

  Fly    42 VAAGSVVGHAIGSGITGLFR-RRDQQPHHSDLV-----------EEGPCAKEMKEFLKCTEDNDD 94
            ||.||.|||.:|..|||.|. ..:.:|...|:.           ::.||..|:|:||:|.::..|
Human    66 VAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGD 130

  Fly    95 LSVCKEFNDAVRRC 108
            :.:|:.||:.:::|
Human   131 IKLCEGFNEVLKQC 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 11/32 (34%)
CHCHD2NP_001307256.1 CHCH 114..147 CDD:310983 11/32 (34%)
Cx9C motif 1. {ECO:0000255|PROSITE-ProRule:PRU01150} 114..124 5/10 (50%)
Cx9C motif 2. {ECO:0000255|PROSITE-ProRule:PRU01150} 134..144 3/10 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13523
Phylome 1 0.910 0.938 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.