DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31008 and gpat3

Sequence 1:NP_733411.1 Gene:CG31008 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001008432.1 Gene:gpat3 XenbaseID:XB-GENE-993435 Length:154 Species:Xenopus tropicalis

Alignment Length:151 Identity:46/152 (30%)
Similarity:61/152 (40%) Gaps:46/152 (30%)


  Fly     1 MPRKQRSASVK-AGSTNYMPAVVPT----------VTNSEMVFKEAAA-------------HAVG 41
            |||..||.:.: |...:..||:.|.          |..:......|||             .|.|
 Frog     1 MPRGSRSRTSRVAPPASRAPAMRPAPPPAAHPPAPVAQAPSALGPAAAAPRQPGLMAQMATTAAG 65

  Fly    42 VAAGSVVGHAIGSGITGLF--------RRRD-----------QQPHHSDLVEEGPCAKEMKEFLK 87
            ||.||.|||.||..|||.|        .|.|           ||...|...   ||..|||:||:
 Frog    66 VAVGSAVGHTIGHAITGGFGGGSSAEPARADITYQEPAQPMYQQQQQSQYT---PCQYEMKQFLE 127

  Fly    88 CTEDNDDLSVCKEFNDAVRRC 108
            |.::..||.:|:.|.:.:::|
 Frog   128 CAQNQSDLKLCEGFGEVLKQC 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 12/32 (38%)
gpat3NP_001008432.1 CHCH 118..151 CDD:310983 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.860

Return to query results.
Submit another query.