DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31008 and CG31007

DIOPT Version :8

Sequence 1:NP_733411.1 Gene:CG31008 / 318554 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster

Alignment Length:176 Identity:67/177 (38%)
Similarity:90/177 (51%) Gaps:62/177 (35%)


  Fly     1 MPRKQ---------------RSASVKA-----GSTNYMPAV--------------VPTVTNSEMV 31
            |||::               ||:.|.|     ||:..:|||              ....|::|..
  Fly     1 MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETK 65

  Fly    32 -------FKEAAAHAVGVAAGSVVGHAIGSGITGLFRRRDQ------QPHHS------------- 70
                   ||:.|..|.||||||.||||:|:|:||:|:.|.|      ||...             
  Fly    66 GPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPK 130

  Fly    71 -DLVEEGPCAKEMKEFLKCTEDN-DDLSVCKEFNDAVRRCHRQYNI 114
             .|||:||||.|:::|||||||| .|||||||||:|:::|.|:||:
  Fly   131 PQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCRRRYNV 176

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 23/34 (68%)
CG31007NP_733412.2 CHCH 139..173 CDD:284221 23/34 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1582
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13523
RoundUp 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.