DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31008 and Chchd2

Sequence 1:NP_733411.1 Gene:CG31008 FlyBaseID:FBgn0051008 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001015019.1 Gene:Chchd2 RGDID:1309819 Length:154 Species:Rattus norvegicus

Alignment Length:121 Identity:42/122 (34%)
Similarity:61/122 (50%) Gaps:17/122 (14%)


  Fly     2 PRKQRSASVKAGSTNYMPAVVPTVTNSEMVFKEAAAHAVGVAAGSVVGHAIGSGITGLF------ 60
            |..|..|:..|.|....||..|   ....:..:.|..|.|||.||.|||.:|..|||.|      
  Rat    30 PAAQPPATAAAPSAVGSPAAAP---RQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGANA 91

  Fly    61 --RRRD---QQPHHSDLVEE---GPCAKEMKEFLKCTEDNDDLSVCKEFNDAVRRC 108
              .|.|   |:|..:.|..:   |||:.|:|:||:|.::..|:.:|:.||:.:|:|
  Rat    92 EPARPDITYQEPQGAPLQNQQSFGPCSLEIKQFLECAQNQSDVKLCEGFNEVLRQC 147

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31008NP_733411.1 CHCH 78..111 CDD:284221 12/32 (38%)
Chchd2NP_001015019.1 CHCH 117..148 CDD:284221 12/32 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR13523
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.