DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and gpat3

DIOPT Version :9

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001008432.1 Gene:gpat3 / 493261 XenbaseID:XB-GENE-993435 Length:154 Species:Xenopus tropicalis


Alignment Length:166 Identity:63/166 - (37%)
Similarity:82/166 - (49%) Gaps:29/166 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPSTA-----DRFKD 75
            |...||:|.| |...||.     ||::....   |||.|.|..|.:....||:.|     .....
 Frog     3 RGSRSRTSRV-APPASRA-----PAMRPAPP---PAAHPPAPVAQAPSALGPAAAAPRQPGLMAQ 58

  Fly    76 MATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAK-----EQPQQEGSLAASASQSVPKPQLVE 135
            |||||||||.||||||.:|..:||.|.|...|.||:     ::|.|........||..       
 Frog    59 MATTAAGVAVGSAVGHTIGHAITGGFGGGSSAEPARADITYQEPAQPMYQQQQQSQYT------- 116

  Fly   136 DGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171
              ||.:|::|||:|.: |.|||.:|:.|.|.::|||
 Frog   117 --PCQYEMKQFLECAQ-NQSDLKLCEGFGEVLKQCR 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/33 (48%)
gpat3NP_001008432.1 CHCH 118..151 CDD:310983 16/33 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2188
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.