DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and gpat3

DIOPT Version :8

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001008432.1 Gene:gpat3 / 493261 XenbaseID:XB-GENE-993435 Length:154 Species:Xenopus tropicalis

Alignment Length:166 Identity:63/167 (38%)
Similarity:82/167 (49%) Gaps:29/167 (17%)


  Fly    16 RRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPSTA-----DRFKD 75
            |...||:|.| |...||.     ||::....   |||.|.|..|.:....||:.|     .....
 Frog     3 RGSRSRTSRV-APPASRA-----PAMRPAPP---PAAHPPAPVAQAPSALGPAAAAPRQPGLMAQ 58

  Fly    76 MATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAK-----EQPQQEGSLAASASQSVPKPQLVE 135
            |||||||||.||||||.:|..:||.|.|...|.||:     ::|.|........||..       
 Frog    59 MATTAAGVAVGSAVGHTIGHAITGGFGGGSSAEPARADITYQEPAQPMYQQQQQSQYT------- 116

  Fly   136 DGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171
              ||.:|::|||:|.: |.|||.:|:.|.|.::|||
 Frog   117 --PCQYEMKQFLECAQ-NQSDLKLCEGFGEVLKQCR 149

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/34 (47%)
gpat3NP_001008432.1 CHCH 118..151 CDD:310983 16/34 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2188
TreeFam 1 0.960
43.890

Return to query results.
Submit another query.