DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and CHCHD10

DIOPT Version :8

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_001288268.1 Gene:CHCHD10 / 400916 HGNCID:15559 Length:149 Species:Homo sapiens

Alignment Length:172 Identity:68/173 (39%)
Similarity:90/173 (52%) Gaps:33/173 (19%)


  Fly     1 MPRQRSEGPRSTGSMRRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETK 65
            |||    |.||..|  |.:||        |:..|:.  |....|...:.||.||:.......:  
Human     1 MPR----GSRSAAS--RPASR--------PAAPSAH--PPAHPPPSAAAPAPAPSGQPGLMAQ-- 47

  Fly    66 GPSTADRFKDMATTAAGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVP- 129
                      |||||||||.||||||.:|:.|||.|.| |.:.|:  ||..:..||.......| 
Human    48 ----------MATTAAGVAVGSAVGHVMGSALTGAFSG-GSSEPS--QPAVQQPLALYPQAPTPA 99

  Fly   130 KPQLVEDGPCAFELRQFLKCTEDNSSDLSVCKEFNEAMQQCR 171
            .||.::.||||:|:||||.|: ...||||:|:.|:||::||:
Human   100 APQPLQMGPCAYEIRQFLDCS-TTQSDLSLCEGFSEALKQCK 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 18/34 (53%)
CHCHD10NP_001288268.1 DUF2076 <40..>88 CDD:331414 25/63 (40%)
CHCH 109..140 CDD:310983 18/32 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111040152
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127883
Panther 1 1.100 O PTHR13523
Phylome 1 0.910 0.923 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2188
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.