DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and Chchd10

DIOPT Version :8

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:NP_780538.2 Gene:Chchd10 / 103172 MGIID:2143558 Length:138 Species:Mus musculus

Alignment Length:155 Identity:58/156 (37%)
Similarity:82/156 (53%) Gaps:26/156 (17%)


  Fly    21 RSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPSTADRFKDMATTAAGVAA 85
            |.|...|.:|   .|:..|....|...   |||||.:|        |........||:||||||.
Mouse     3 RGSRSAAARP---VSRPAPPPAHPPPS---AAAPAPAA--------PGQPGLMAQMASTAAGVAV 53

  Fly    86 GSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQFLKCT 150
            ||||||.:|:.||..|.| |.:.||:...||        :.:.|....::.|||::|::|||.|:
Mouse    54 GSAVGHVMGSALTSAFSG-GNSEPAQPAVQQ--------APARPASHPLQMGPCSYEIKQFLDCS 109

  Fly   151 EDNSSDLSVCKEFNEAMQQCRRRYN 175
             ...|||::|:.|:||::||  :||
Mouse   110 -TTQSDLTLCEGFSEALKQC--KYN 131

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 15/34 (44%)
Chchd10NP_780538.2 CHCH 98..131 CDD:310983 16/36 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111040078
eggNOG 1 0.900 E1_KOG4090
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127883
Panther 1 1.100 O PTHR13523
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2188
TreeFam 1 0.960
76.820

Return to query results.
Submit another query.