DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31007 and LOC100910788

DIOPT Version :8

Sequence 1:NP_733412.2 Gene:CG31007 / 318553 FlyBaseID:FBgn0051007 Length:176 Species:Drosophila melanogaster
Sequence 2:XP_017460031.1 Gene:LOC100910788 / 100910788 RGDID:6496638 Length:148 Species:Rattus norvegicus

Alignment Length:156 Identity:60/157 (38%)
Similarity:82/157 (52%) Gaps:16/157 (10%)


  Fly    16 RRQSSRSSHVFATKPSRGSSKDLPAVQQPKKESLPAAAPAASAATSTETKGPSTADRFKDMATTA 80
            |...||:|.|  |.|:|.:.:..||.|.|...:.|:|..:.:||       |........|||||
  Rat     3 RGSRSRTSRV--TPPARAAPRRAPAAQPPATAAAPSAVGSPAAA-------PRQPGLMAQMATTA 58

  Fly    81 AGVAAGSAVGHAVGAGLTGMFQGRGQAAPAKEQPQQEGSLAASASQSVPKPQLVEDGPCAFELRQ 145
            ||||.||||||.:|..:||.|.|...|.||:.      .:.....|..|.......|||:.|::|
  Rat    59 AGVAVGSAVGHTLGHAITGGFSGGANAEPARP------DITYQEPQGAPLQNQQSFGPCSLEIKQ 117

  Fly   146 FLKCTEDNSSDLSVCKEFNEAMQQCR 171
            ||:|.: |.||:.:|:.|||.::|||
  Rat   118 FLECAQ-NQSDVKLCEGFNEVLRQCR 142

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31007NP_733412.2 CHCH 139..173 CDD:284221 16/34 (47%)
LOC100910788XP_017460031.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000297
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.