DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and DAP1

DIOPT Version :10

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_015155.1 Gene:DAP1 / 855933 SGDID:S000006091 Length:152 Species:Saccharomyces cerevisiae


Alignment Length:108 Identity:32/108 - (29%)
Similarity:51/108 - (47%) Gaps:15/108 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 FTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDF------ 122
            |.|..|:||||.::.: :::|:.|.|:|.:||.:.||....|..|.|.|||.......|      
Yeast    44 FFPRTLSKFNGHDDEK-IFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIK 107

  Fly   123 ---ETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVI 162
               :..||  .||   |..:.:..|..|::.::..|...|.:|
Yeast   108 DWDQPIDP--LDD---LTKEQIDALDEWQEHFENKYPCIGTLI 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 65..>122 CDD:459698 20/56 (36%)
DAP1NP_015155.1 Cyt-b5 46..108 CDD:459698 21/62 (34%)

Return to query results.
Submit another query.