powered by:
                  
 
    
 
    
             
          
            Protein Alignment CG12056 and DAP1
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_572535.1 | 
            Gene: | CG12056 / 31855 | 
            FlyBaseID: | FBgn0030099 | 
            Length: | 287 | 
            Species: | Drosophila melanogaster | 
          
          
            | Sequence 2: | NP_015155.1 | 
            Gene: | DAP1 / 855933 | 
            SGDID: | S000006091 | 
            Length: | 152 | 
            Species: | Saccharomyces cerevisiae | 
          
        
        
        
          
            | Alignment Length: | 108 | 
            Identity: | 32/108 - (29%) | 
          
          
            | Similarity: | 51/108 -  (47%) | 
            Gaps: | 15/108 - (13%) | 
          
        
      
- Green bases have known domain annotations that are detailed below.
      | 
 
  Fly    64 FTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDF------ 122 
            |.|..|:||||.::.: :::|:.|.|:|.:||.:.||....|..|.|.|||.......|       
Yeast    44 FFPRTLSKFNGHDDEK-IFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIK 107 
 
  Fly   123 ---ETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVI 162 
               :..||  .||   |..:.:..|..|::.::..|...|.:| 
Yeast   108 DWDQPIDP--LDD---LTKEQIDALDEWQEHFENKYPCIGTLI 145 
 
       | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | 
            Simple Score | 
            Weighted Score | 
            Original Tool Information | 
          
          
            | BLAST Result | 
            Score | 
            Score Type | 
            Cluster ID | 
          
          
          
            | Compara | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Domainoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | eggNOG | 
            1 | 
            0.900 | 
            - | 
            - | 
             | 
            E1_KOG1110 | 
          
          
            | Hieranoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Homologene | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Inparanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Isobase | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OMA | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoFinder | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | OrthoInspector | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | orthoMCL | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Panther | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | Phylome | 
            1 | 
            0.910 | 
            - | 
            - | 
             | 
             | 
          
          
            | RoundUp | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | SonicParanoid | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
            | TreeFam | 
            0 | 0.000 | 
            
              Not matched by this tool. | 
          
          
             | 
            2 | 1.810 | 
             | 
          
        
      
           
             Return to query results.
             Submit another query.