DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and DAP1

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_015155.1 Gene:DAP1 SGDID:S000006091 Length:152 Species:Saccharomyces cerevisiae

Alignment Length:108 Identity:32/109 (29%)
Similarity:51/109 (47%) Gaps:15/109 (14%)


  Fly    64 FTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDF------ 122
            |.|..|:||||.::.: :::|:.|.|:|.:||.:.||....|..|.|.|||.......|      
Yeast    44 FFPRTLSKFNGHDDEK-IFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIK 107

  Fly   123 ---ETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVI 162
               :..||  .||   |..:.:..|..|::.::..|...|.:|
Yeast   108 DWDQPIDP--LDD---LTKEQIDALDEWQEHFENKYPCIGTLI 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 21/53 (40%)
DAP1NP_015155.1 Cyt-b5 46..108 CDD:306642 21/63 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.