DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and MAPR4

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_567451.1 Gene:MAPR4 AraportID:AT4G14965 Length:245 Species:Arabidopsis thaliana

Alignment Length:231 Identity:88/232 (38%)
Similarity:125/232 (54%) Gaps:38/232 (16%)


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||:..|||.:||.:|..|:.|.:|||||||::|..|||||..||.|.|||||.:|:||:| |.|.
plant    41 LFSAEELALYNGTDETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSGNF-TGDG 104

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTYHHKFLELLEQARDA--- 189
            .| |.:..|...::..:..||.||.:.|...|:::||:||.:|. .|.|.|..| .:.:|.|   
plant   105 LT-DSLQGLSSSEVKSIVDWRGFYSRTYTPVGKLVGRYYDSQGN-PTKHLKGAE-AKASRGAQLM 166

  Fly   190 -KRQVEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPR------KLYSRGNKSFQCA 247
             |::.||  |:...||..||::.|..|||.           :|.||      ::...|:.|.:||
plant   167 EKQKTEE--AKQSNCNSRWSQDEGGEVWCD-----------VGVPRLVQRPLEIAITGSMSKRCA 218

  Fly   248 CVPDAELDEIDAGGKVAHGDAMLKPYDNCEPQAREC 283
            |.   |.|::|..|        |:.|.:|||.|:.|
plant   219 CF---EEDQLDQSG--------LEIYKDCEPLAKTC 243

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 31/54 (57%)
MAPR4NP_567451.1 Cyt-b5 41..>95 CDD:278597 31/54 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H14701
Inparanoid 1 1.050 135 1.000 Inparanoid score I1774
OMA 1 1.010
OrthoDB 1 1.010 D1355837at2759
OrthoInspector 1 1.000 T125014
orthoMCL 1 0.900 OOG5_132425
Panther 1 1.100 O PTHR10281
Phylome 1 0.910 0.633 Consistency score
98.980

Return to query results.
Submit another query.