DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and MAPR4

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_567451.1 Gene:MAPR4 / 827155 AraportID:AT4G14965 Length:245 Species:Arabidopsis thaliana


Alignment Length:231 Identity:88/231 - (38%)
Similarity:125/231 - (54%) Gaps:38/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||:..|||.:||.:|..|:.|.:|||||||::|..|||||..||.|.|||||.:|:||:| |.|.
plant    41 LFSAEELALYNGTDETLPILLGILGSVFDVTKGKFHYGSGGGYNHFAGRDASRAFVSGNF-TGDG 104

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTYHHKFLELLEQARDA--- 189
            .| |.:..|...::..:..||.||.:.|...|:::||:||.:|. .|.|.|..| .:.:|.|   
plant   105 LT-DSLQGLSSSEVKSIVDWRGFYSRTYTPVGKLVGRYYDSQGN-PTKHLKGAE-AKASRGAQLM 166

  Fly   190 -KRQVEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPR------KLYSRGNKSFQCA 247
             |::.||  |:...||..||::.|..|||.           :|.||      ::...|:.|.:||
plant   167 EKQKTEE--AKQSNCNSRWSQDEGGEVWCD-----------VGVPRLVQRPLEIAITGSMSKRCA 218

  Fly   248 CVPDAELDEIDAGGKVAHGDAMLKPYDNCEPQAREC 283
            |.   |.|::|..|        |:.|.:|||.|:.|
plant   219 CF---EEDQLDQSG--------LEIYKDCEPLAKTC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 31/53 (58%)
MAPR4NP_567451.1 Cyt-b5 41..>95 CDD:278597 31/53 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3338
eggNOG 1 0.900 - - E1_KOG1110
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H14701
Inparanoid 1 1.050 136 1.000 Inparanoid score I1827
OMA 1 1.010 - - QHG59781
OrthoDB 1 1.010 - - D1355837at2759
OrthoFinder 1 1.000 - - FOG0006068
OrthoInspector 1 1.000 - - oto3154
orthoMCL 1 0.900 - - OOG6_104240
Panther 1 1.100 - - LDO PTHR10281
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4364
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.