DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and cyb5d2

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001096144.1 Gene:cyb5d2 ZFINID:ZDB-GENE-050506-83 Length:267 Species:Danio rerio

Alignment Length:257 Identity:95/258 (37%)
Similarity:129/258 (50%) Gaps:26/258 (10%)


  Fly    27 TEIRQFLRRQTDNYLDQAGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFD 91
            |.:..:||::....      .||.|         |.|.|..:|:.:||.:..:.||||:||.|||
Zfish    32 TVLESWLRQRVSEV------SASSP---------GLLLTKEQLSLYNGGKNSKGLYLAILGQVFD 81

  Fly    92 VSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYV 156
            |.:|.||||.|..|:||.|:|||.:||:|||.  :...::||.......::.|..|..|||:||.
Zfish    82 VEKGRKHYGPGGGYHFFTGKDASRAFITGDFT--EAGLSNDVSDFSESQIVALYDWLSFYQRDYT 144

  Fly   157 YKGRVIGRFYDEKGALTTYHHKFLELLEQARDAKRQVEELRARYPGCNIEWSEERGTRVWCTTTS 221
            ..|::|||||.|.|..|.........|......|.|.:.....||.||.||||..|.||||:|.|
Zfish   145 PVGKLIGRFYTETGQPTDALLHVEAFLSDGLKKKAQAQSEMQLYPSCNSEWSEASGGRVWCSTMS 209

  Fly   222 GDGKERSWIGYPRKLYSRGNKSFQCACVPDAELDEIDAGGKVAHGDAMLKPYDNCEPQAREC 283
            | |..|.|:|.||.|::.|:...:|.|        |.....|...:..|:.|.:|.|:|..|
Zfish   210 G-GIHRDWVGVPRMLFTPGSGHSRCVC--------IRLSDPVHSENRNLREYTDCPPRAESC 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 28/54 (52%)
cyb5d2NP_001096144.1 Cyt-b5 55..124 CDD:278597 34/71 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190139304
eggNOG 1 0.900 E1_KOG1110
Hieranoid 1 1.000
Homologene 1 1.000 H14701
Inparanoid 1 1.050 168 1.000 Inparanoid score I4069
OMA 1 1.010
OrthoDB 1 1.010 D1355837at2759
OrthoFinder 1 1.000 FOG0006080
OrthoInspector 1 1.000 T1054669
orthoMCL 1 0.900 OOG5_132425
Panther 1 1.100 LDO PTHR10281
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2676
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.