DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and nenf

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001025625.1 Gene:nenf XenbaseID:XB-GENE-972221 Length:164 Species:Xenopus tropicalis

Alignment Length:116 Identity:42/117 (36%)
Similarity:65/117 (56%) Gaps:15/117 (13%)


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRD-----ASVSFISGDF 122
            |||..:||.:|||::.:|:|:|:.|:|||||.|.:.||.|.|||...|:|     |.:|....|.
 Frog    38 LFTEDDLATYNGEKDEQPIYMAVKGTVFDVSAGKEFYGKGASYNALAGKDSTRAVAKMSLDPADL 102

  Fly   123 ETYDPE--TADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGA 171
             |||..  |.:::.:|  ||:     :.:.|::.|...|....|..:|.|:
 Frog   103 -TYDTAGLTEEELKSL--DDI-----FENVYKRKYPIVGYTARRILNEDGS 145

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 28/59 (47%)
nenfNP_001025625.1 Cyt-b5 38..>93 CDD:278597 26/55 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.