powered by:
                   
 
    
    
             
          
            Protein Alignment CG12056 and pgrmc2
  DIOPT Version :9 
      
        
          
            | Sequence 1: | NP_572535.1 | Gene: | CG12056 / 31855 | FlyBaseID: | FBgn0030099 | Length: | 287 | Species: | Drosophila melanogaster | 
          
            | Sequence 2: | NP_998269.1 | Gene: | pgrmc2 / 406378 | ZFINID: | ZDB-GENE-040426-2102 | Length: | 201 | Species: | Danio rerio | 
        
        
        
          
            | Alignment Length: | 170 | Identity: | 50/170 - (29%) | 
          
            | Similarity: | 70/170 -  (41%) | Gaps: | 30/170 - (17%) | 
        
      
- Green bases have known domain annotations that are detailed below.
      | 
  Fly    14 LFVVAAVLGGIYHTEIRQFLRRQTDNYLDQAGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEG 78|.|:..||...|....|.:.|...|  |.: |.:|| ||......|    ||..:|..::|.:..
 Zfish    39 LSVLVLVLAACYVLYARWWRRAGAD--LGR-GSEAS-PLPKMRRRD----FTLQQLRDYDGVQNP 95
 
 
  Fly    79 RPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDPETADDVLTLKPDDLIG 143| :.:|:...||||:.|.|.||....|..|.|||||....:...|       .|.|..:.|||..
 Zfish    96 R-ILMAVNTKVFDVTSGKKFYGREGPYGIFAGRDASRGLATFCLE-------KDALRDEYDDLSD 152
 
 
  Fly   144 LAG--------WRDFYQKDYVYKGRVI------GRFYDEK 169|..        |...:.:.|.|.||::      ..:.||:
 Zfish   153 LNAVQMESVREWEMQFMEKYDYVGRLLKPGDEPSEYTDEE 192
 
 | 
      
        Known Domains:
         Indicated by green bases in alignment.
        
      
      
      
        Information from Original Tools:
        
        
          
            | Tool | Simple Score | Weighted Score | Original Tool Information | 
          
            | BLAST Result | Score | Score Type | Cluster ID | 
          
          
            | Compara | 0 | 0.000 | Not matched by this tool. | 
          
            | Domainoid | 0 | 0.000 | Not matched by this tool. | 
          
            | eggNOG | 1 | 0.900 | - | - |  | E1_KOG1110 | 
          
            | Hieranoid | 0 | 0.000 | Not matched by this tool. | 
          
            | Homologene | 0 | 0.000 | Not matched by this tool. | 
          
            | Inparanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | OMA | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoDB | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoFinder | 0 | 0.000 | Not matched by this tool. | 
          
            | OrthoInspector | 0 | 0.000 | Not matched by this tool. | 
          
            | orthoMCL | 0 | 0.000 | Not matched by this tool. | 
          
            | Panther | 0 | 0.000 | Not matched by this tool. | 
          
            | Phylome | 1 | 0.910 | - | - |  |  | 
          
            | RoundUp | 0 | 0.000 | Not matched by this tool. | 
          
            | SonicParanoid | 0 | 0.000 | Not matched by this tool. | 
          
            | SwiftOrtho | 0 | 0.000 | Not matched by this tool. | 
          
            | TreeFam | 0 | 0.000 | Not matched by this tool. | 
          
            | ZFIN | 0 | 0.000 | Not matched by this tool. | 
          
            |  | 2 | 1.810 |  | 
        
      
           
             Return to query results.
             Submit another query.