DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and Pgrmc2

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001008375.1 Gene:Pgrmc2 RGDID:1308804 Length:217 Species:Rattus norvegicus

Alignment Length:174 Identity:50/175 (29%)
Similarity:79/175 (45%) Gaps:23/175 (13%)


  Fly    16 VVAAVLGGIYHTEIRQFLRRQTDNYLDQAGQD---ASIPLAFQAGDDIGTLFTPAELAKFNGEEE 77
            :||.||.|.|...:|...|.....  ..||::   |::| ..:..|     |:..:|.:::|...
  Rat    54 LVALVLLGAYRLWVRWGRRGLCSG--PGAGEESPAATLP-RMKKRD-----FSLEQLRQYDGART 110

  Fly    78 GRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDAS--VSFISGDFETYDPETADDVLTLKPDD 140
            .| :.||:.|.||||::|.|.||....|..|.|||||  ::....|.:....| .||:..|....
  Rat   111 PR-ILLAVNGKVFDVTKGSKFYGPAGPYGIFAGRDASRGLATFCLDKDALRDE-YDDLSDLNAVQ 173

  Fly   141 LIGLAGWRDFYQKDYVYKGRVI------GRFYDEKGALTTYHHK 178
            :..:..|...:::.|.|.||::      ..:.||:.  |..|.|
  Rat   174 MESVREWEMQFKEKYDYVGRLLKPGEEPSEYTDEED--TKDHSK 215

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 22/56 (39%)
Pgrmc2NP_001008375.1 Cyt-b5 96..194 CDD:278597 33/105 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.