DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and CG16957

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001285897.1 Gene:CG16957 FlyBaseID:FBgn0032519 Length:192 Species:Drosophila melanogaster

Alignment Length:130 Identity:35/131 (27%)
Similarity:64/131 (49%) Gaps:9/131 (7%)


  Fly    33 LRRQTDNYLDQAGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIK 97
            |.|:..::.|...|:..:|       .:...||..||.:::|......:.:|:|.:::||||.:.
  Fly    49 LSREEPDFSDDNNQEVDLP-------PLRKDFTVRELREYDGTRADGRILVAILFNIYDVSRSVH 106

  Fly    98 HYG-SGCSYNFFVGRDASVSFISGDFETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRV 161
            :|| :|.:.| :.|||.|...|:...:..|.|..||:..|..:.:..|..|...|:..|.:.|::
  Fly   107 YYGRNGVNPN-YAGRDISRILINSPEDLKDSEDFDDLSDLSRNQMNTLREWEQRYKMKYPFVGKL 170

  Fly   162  161
              Fly   171  170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 19/55 (35%)
CG16957NP_001285897.1 Cyt-b5 72..170 CDD:278597 30/99 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109823606
eggNOG 1 0.900 E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10281
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.