DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and MSBP

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001162765.1 Gene:MSBP FlyBaseID:FBgn0030703 Length:248 Species:Drosophila melanogaster

Alignment Length:100 Identity:33/100 (33%)
Similarity:57/100 (57%) Gaps:2/100 (2%)


  Fly    64 FTPAELAKFNG-EEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||..||.:::| :.:||.| :|:.|||:|||:|.:.||.|..|..|.|||||.:..:....:.|.
  Fly    83 FTVKELRQYDGTQPDGRVL-VAVNGSVYDVSKGRRFYGPGGPYATFAGRDASRNLATFSVVSIDK 146

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVI 162
            :..||:..|...::..:..|...:::.|...|:::
  Fly   147 DEYDDLSDLSAVEMDSVREWEMQFKEKYELVGKLL 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 26/54 (48%)
MSBPNP_001162765.1 Cyt-b5 82..180 CDD:278597 33/98 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109823603
eggNOG 1 0.900 E1_KOG1110
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10281
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.