DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and Cyb5d2

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001007672.1 Gene:Cyb5d2 RGDID:1359124 Length:263 Species:Rattus norvegicus

Alignment Length:228 Identity:92/229 (40%)
Similarity:127/229 (55%) Gaps:8/229 (3%)


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||.|.|||::.|......|||||||.|:|||.|.|||..|..|:.|.|||||.:|::||:.  :.
  Rat    37 LFVPEELARYRGGPGDPGLYLALLGRVYDVSSGRKHYEPGAHYSGFAGRDASRAFVTGDYS--EA 99

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTYHHKFLELLEQARDAKRQ 192
            ...|||..|...:::.|..|..||:|:||:.||:|||||.:.|..|:...:...::.:..:|..|
  Rat   100 GLVDDVNGLSSSEILTLHNWLSFYEKNYVFVGRLIGRFYGKDGLPTSELTQVEAMVTKGMEANEQ 164

  Fly   193 VEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPRKLYSRGNKSFQCACV-----PDA 252
            .:..:.|:|.||.|||..:|:|:||:..|| |..|.|||.|||||..|.|...|.||     |..
  Rat   165 EQREKQRFPPCNAEWSSAKGSRLWCSQKSG-GVHRDWIGVPRKLYKPGAKEPHCVCVRTTGPPSD 228

  Fly   253 ELDEIDAGGKVAHGDAMLKPYDNCEPQARECFY 285
            :.|......:....:..|:.|..|.|.|..||:
  Rat   229 QQDNPRHSNRGDLDNPNLEEYTGCPPLAVTCFF 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 30/54 (56%)
Cyb5d2NP_001007672.1 Cyt-b5 37..>91 CDD:278597 30/54 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190138389
eggNOG 1 0.900 E1_KOG1110
Hieranoid 1 1.000
Homologene 1 1.000 H14701
Inparanoid 1 1.050 173 1.000 Inparanoid score I3928
OMA 1 1.010
OrthoDB 1 1.010 D1355837at2759
OrthoFinder 1 1.000 FOG0006080
OrthoInspector 1 1.000 T1089082
orthoMCL 1 0.900 OOG5_132425
Panther 1 1.100 LDO PTHR10281
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.