DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and NENF

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_037481.1 Gene:NENF HGNCID:30384 Length:172 Species:Homo sapiens

Alignment Length:142 Identity:47/143 (33%)
Similarity:64/143 (45%) Gaps:31/143 (22%)


  Fly    43 QAGQDASIPLAFQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNF 107
            :|||   .|...:.|..: .|||..|||::.||||.:|:|||:.|.||||:.|.:.||.|..||.
Human    30 RAGQ---TPRPAERGPPV-RLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNA 90

  Fly   108 FVGRD-----ASVSFISGDFETYDP--------ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKG 159
            ..|:|     |.:|....|. |:|.        |..|:|.|             ..|:..|...|
Human    91 LTGKDSTRGVAKMSLDPADL-THDTTGLTAKELEALDEVFT-------------KVYKAKYPIVG 141

  Fly   160 RVIGRFYDEKGA 171
            ....|..:|.|:
Human   142 YTARRILNEDGS 153

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 29/59 (49%)
NENFNP_037481.1 Cyt-b5 48..>109 CDD:306642 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1110
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.