DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12056 and Pgrmc1

DIOPT Version :9

Sequence 1:NP_572535.1 Gene:CG12056 / 31855 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_068534.2 Gene:Pgrmc1 / 291948 RGDID:70890 Length:195 Species:Rattus norvegicus


Alignment Length:189 Identity:52/189 - (27%)
Similarity:76/189 - (40%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GLLRHLFKFQF--------LFVVAAVLGGIYHTEIRQFLRRQTDNYLDQAG------QDASIPLA 53
            |||:.:|....        :|::..::.|                  ||.|      .|...||.
  Rat    20 GLLQEIFTSPLNLLLLGLCIFLLYKIVRG------------------DQPGASGDNDDDEPPPLP 66

  Fly    54 FQAGDDIGTLFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDAS--VS 116
            .....|    ||||||.:::|.::.| :.:|:.|.||||::|.|.||....|..|.|||||  ::
  Rat    67 RLKPRD----FTPAELRRYDGVQDPR-ILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLA 126

  Fly   117 FISGDFETYDPETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTY 175
            ....|.|....| .||:..|.|.....|..|    ...:.:|...:|:...|....|.|
  Rat   127 TFCLDKEALKDE-YDDLSDLTPAQQETLNDW----DSQFTFKYHHVGKLLKEGEEPTVY 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 25/55 (45%)
Pgrmc1NP_068534.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..72 4/20 (20%)
Cyt-b5 74..137 CDD:395121 26/63 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 173..195 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.