DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and Cyb5d2

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001020097.2 Gene:Cyb5d2 MGIID:2684848 Length:263 Species:Mus musculus

Alignment Length:230 Identity:91/231 (39%)
Similarity:129/231 (56%) Gaps:12/231 (5%)


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||.|.|||::.|......|||||||.|:|||.|.:||..|..|:.|.|||||.:|::||:.  :.
Mouse    37 LFLPEELARYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGAHYSGFAGRDASRAFVTGDYS--EA 99

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKGALTTYHHKFLELLEQARDAKRQ 192
            ...||:..|...:::.|..|..||:|:||:.||::||||.:.|..|:...:...::.:..:|..|
Mouse   100 GLVDDINGLSSSEILTLHNWLSFYEKNYVFVGRLVGRFYRKDGLPTSELTQVEAMVTKGMEANEQ 164

  Fly   193 VEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPRKLYSRGNKSFQCACV----PDAE 253
            .:..:.::|.||.|||..:|:|:||:..|| |..|.|||.|||||..|.|...|.||    |.: 
Mouse   165 EQREKQKFPPCNSEWSSAKGSRLWCSQKSG-GVHRDWIGVPRKLYKPGAKEPHCVCVRTTGPPS- 227

  Fly   254 LDEIDAGGKVAHGD---AMLKPYDNCEPQARECFY 285
             |:.|......|||   ..|:.|..|.|.|..|.:
Mouse   228 -DQQDNPRHSNHGDLDNPNLEEYTGCPPLATTCSF 261

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 29/54 (54%)
Cyb5d2NP_001020097.2 Cyt-b5 37..>91 CDD:278597 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190139620
eggNOG 1 0.900 E1_KOG1110
Hieranoid 1 1.000
Homologene 1 1.000 H14701
Inparanoid 1 1.050 170 1.000 Inparanoid score I4102
Isobase 1 0.950 0 Normalized mean entropy S2222
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006080
OrthoInspector 1 1.000 T1085543
orthoMCL 1 0.900 OOG5_132425
Panther 1 1.100 LDO PTHR10281
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2676
TreeFam 1 0.960
1413.740

Return to query results.
Submit another query.