DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12056 and CYB5D2

Sequence 1:NP_572535.1 Gene:CG12056 FlyBaseID:FBgn0030099 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_653212.1 Gene:CYB5D2 HGNCID:28471 Length:264 Species:Homo sapiens

Alignment Length:235 Identity:96/236 (41%)
Similarity:125/236 (53%) Gaps:21/236 (9%)


  Fly    63 LFTPAELAKFNGEEEGRPLYLALLGSVFDVSRGIKHYGSGCSYNFFVGRDASVSFISGDFETYDP 127
            ||.|.||:::.|......|||||||.|:|||.|.:||..|..|:.|.|||||.:|::||..  :.
Human    37 LFIPEELSRYRGGPGDPGLYLALLGRVYDVSSGRRHYEPGSHYSGFAGRDASRAFVTGDCS--EA 99

  Fly   128 ETADDVLTLKPDDLIGLAGWRDFYQKDYVYKGRVIGRFYDEKG----ALTTYHHKFLELLEQARD 188
            ...|||..|...:::.|..|..||:|:||..|||.||||.|.|    |||.........||.   
Human   100 GLVDDVSDLSAAEMLTLHNWLSFYEKNYVCVGRVTGRFYGEDGLPTPALTQVEAAITRGLEA--- 161

  Fly   189 AKRQVEELRARYPGCNIEWSEERGTRVWCTTTSGDGKERSWIGYPRKLYSRGNKSFQCACV---- 249
            .|.|::| :..:|.||.|||..||:|:||:..|| |..|.|||.|||||..|.|..:|.||    
Human   162 NKLQLQE-KQTFPPCNAEWSSARGSRLWCSQKSG-GVSRDWIGVPRKLYKPGAKEPRCVCVRTTG 224

  Fly   250 -PDAELDEIDA---GGKVAHGDAMLKPYDNCEPQARECFY 285
             |..::.:...   .|.:.|.:  |..|..|.|.|..|.:
Human   225 PPSGQMPDNPPHRNRGDLDHPN--LAEYTGCPPLAITCSF 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12056NP_572535.1 Cyt-b5 63..>117 CDD:278597 28/54 (52%)
CYB5D2NP_653212.1 Cyt-b5 40..>100 CDD:306642 29/62 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C190140086
eggNOG 1 0.900 E1_KOG1110
Hieranoid 1 1.000
Homologene 1 1.000 H14701
Inparanoid 1 1.050 155 1.000 Inparanoid score I4238
Isobase 1 0.950 0 Normalized mean entropy S2222
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006080
OrthoInspector 1 1.000 T1075434
orthoMCL 1 0.900 OOG5_132425
Panther 1 1.100 LDO PTHR10281
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2676
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.