DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG12115 and CG12057

Sequence 1:NP_572533.1 Gene:CG12115 FlyBaseID:FBgn0030097 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001259379.1 Gene:CG12057 FlyBaseID:FBgn0030098 Length:219 Species:Drosophila melanogaster

Alignment Length:194 Identity:62/195 (32%)
Similarity:94/195 (48%) Gaps:14/195 (7%)


  Fly    72 LDRTLRLLIAESKALAK---EIILLTERQLLKIFLWPIKELEKLAEDVERRALDAGECAINVTSS 133
            ||..:|.::.|..::.|   |::|   .|..:|.|.|..|||...|.||.|..::.||.......
  Fly    28 LDAQVRSVVDEMTSIGKATGEVLL---SQYEEIVLEPQNELEAAVEQVESRREESPECVAAEDEE 89

  Fly   134 SADLVASTTLDFLGCARDAAVTSINLVLDTKKAVLQLTLDGYQLYQLRKECNSYKANSIRKKTCK 198
            ...:|.:...|...|...||.||..:..|...|..||...||.|.....:||||| ||:.|:||.
  Fly    90 ITRIVNAAHEDLYACGVVAAQTSAEIASDVSAATQQLVYGGYSLASTYNKCNSYK-NSVLKQTCL 153

  Fly   199 VKFTTKGILYVANGQASLRYLIRLRKS----VPAVATDATSCTTKSTENAIQGFDDLNAAIDAC 258
            .||..:..:|:.:.::|::   .:|:|    :|.|..|...||..::..|:.|..::|..||||
  Fly   154 AKFYVQATVYLVSARSSIK---TIRQSTSERIPDVFADGNVCTHSASSQAVLGLQEVNNNIDAC 214

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12115NP_572533.1 None
CG12057NP_001259379.1 DUF725 79..198 CDD:283039 37/123 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140881035
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.