DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fh and YFH1

DIOPT Version :8

Sequence 1:NP_511094.1 Gene:fh / 31845 FlyBaseID:FBgn0030092 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_010163.1 Gene:YFH1 / 851437 SGDID:S000002278 Length:174 Species:Saccharomyces cerevisiae

Alignment Length:128 Identity:51/129 (40%)
Similarity:67/129 (52%) Gaps:19/129 (15%)


  Fly    65 ESTLDGAT------------YERVCSDTLDALCDYFEELTENASELQGTDVAYSDGVLTVNLGGQ 117
            ||:.||..            |.....|.||.|.|..|||:|...:.. .||..|.||:|:.:.. 
Yeast    53 ESSTDGQVVPQEVLNLPLEKYHEEADDYLDHLLDSLEELSEAHPDCI-PDVELSHGVMTLEIPA- 115

  Fly   118 HGTYVINRQTPNKQIWLSSPTSGPKRYDFVGTVAAGRWIYKHSGQSLHELLQQEI-PGILKSQ 179
            .||||||:|.|||||||:||.|||.|:|.:.    |.|:...:|..|.::|.:|: ..|.|||
Yeast   116 FGTYVINKQPPNKQIWLASPLSGPNRFDLLN----GEWVSLRNGTKLTDILTEEVEKAISKSQ 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
fhNP_511094.1 mito_frataxin 72..173 CDD:132463 43/114 (38%)
YFH1NP_010163.1 mito_frataxin 72..168 CDD:132463 43/102 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C247262474
eggNOG 1 0.900 E1_COG1965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I1608
Isobase 1 0.950 0 Normalized mean entropy S1580
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004540
OrthoInspector 1 1.000 T1136908
orthoMCL 1 0.900 OOG5_128372
Panther 1 1.100 LDO PTHR16821
Phylome 1 0.910 0.957 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R456
TreeFam 1 0.960
1211.730

Return to query results.
Submit another query.