DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and TCP1

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_010498.1 Gene:TCP1 SGDID:S000002620 Length:559 Species:Saccharomyces cerevisiae

Alignment Length:533 Identity:184/534 (34%)
Similarity:293/534 (55%) Gaps:40/534 (7%)


  Fly    24 RLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILVDMS 88
            |..:.:..:|:.::|||:|||.|:||:||   .:.|...|||||||||..:.|.:||.||||:::
Yeast    26 RNQNVLATMAVANVVKSSLGPVGLDKMLV---DDIGDFTVTNDGATILSLLDVQHPAGKILVELA 87

  Fly    89 RVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDNSSSDE 153
            :.||.|:|||||||.::|||||:.|.:||:.|:||..|::|:|.|.:.|:..:....  ::|.|.
Yeast    88 QQQDREIGDGTTSVVIIASELLKRANELVKNKIHPTTIITGFRVALREAIRFINEVL--STSVDT 150

  Fly   154 KFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLK---GSGEL----KSIQIIKKSGGTLGD 211
            ..:..|:|||:|::||||:....|||:|:.|||::.:|   ..||:    |::.::|..|.:..:
Yeast   151 LGKETLINIAKTSMSSKIIGADSDFFSNMVVDALLAVKTQNSKGEIKYPVKAVNVLKAHGKSATE 215

  Fly   212 SFLDEGFLLD-KKPGVHQPQRIENARILIANTPMDTDKIKV-FGSSIKVDSLAKIADLEMAEKEK 274
            |.|..|:.|: .......|:||....:.||...::..|.:: .|..|.:|...::..:...|...
Yeast   216 SLLVPGYALNCTVASQAMPKRIAGGNVKIACLDLNLQKARMAMGVQINIDDPEQLEQIRKREAGI 280

  Fly   275 MKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIVS------ 333
            :.|:|.||:.....|.:..:.|.:...:.|.:|::|.:.....:.:.|:|..||..:||      
Yeast   281 VLERVKKIIDAGAQVVLTTKGIDDLCLKEFVEAKIMGVRRCKKEDLRRIARATGATLVSSMSNLE 345

  Fly   334 ---TFENPSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHDALC 395
               |||:.   .||.||.:.|....:|..:...|.....:.:|::|||....|||.:|||||:|.
Yeast   346 GEETFESS---YLGLCDEVVQAKFSDDECILIKGTSKHSSSSIILRGANDYSLDEMERSLHDSLS 407

  Fly   396 VLAATVKESRIIFGGGCSEALMATAVLKKAAETPG-KEAIAIEAFARALLSLPTAIADNAGYDSA 459
            |:..|::...::.||||.||.: ...|...|.|.| :|.:||..||.|||.:|..:|.||..||:
Yeast   408 VVKRTLESGNVVPGGGCVEAAL-NIYLDNFATTVGSREQLAIAEFAAALLIIPKTLAVNAAKDSS 471

  Fly   460 QLVSELRAGHAQGK------------QTLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAE 512
            :||::||:.||..:            :..|||:..||:.|....|:.|....|.:.|.||.||..
Yeast   472 ELVAKLRSYHAASQMAKPEDVKRRSYRNYGLDLIRGKIVDEIHAGVLEPTISKVKSLKSALEACV 536

  Fly   513 MILRVDNIIRCAP 525
            .|||:|.:|...|
Yeast   537 AILRIDTMITVDP 549

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 184/534 (34%)
TCP1_beta 10..527 CDD:239452 184/534 (34%)
TCP1NP_010498.1 TCP1_alpha 17..549 CDD:239451 183/532 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.