DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and CCT3

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001189236.1 Gene:CCT3 FlyBaseID:FBgn0015019 Length:544 Species:Drosophila melanogaster

Alignment Length:563 Identity:167/564 (30%)
Similarity:274/564 (49%) Gaps:83/564 (15%)


  Fly     7 PVRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATIL 71
            |:.||....:.|.....:|.:.....||.|::::.|||:.|.|:|:..   .|.:.:||||..||
  Fly     7 PILVLSQNTKRESGRKVQLENIQAGKAIADVIRTCLGPQAMLKMLMDP---MGGIVMTNDGNAIL 68

  Fly    72 RAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQV 136
            |.:.|.:||||.:::::|.||||||||||||.|||.|:|..||..::|::||.:|:..:|:    
  Fly    69 REITVQHPAAKSMIEIARTQDEEVGDGTTSVIVLAGEMLAAAEPFLQQQIHPTVIIRAYRE---- 129

  Fly   137 ALEALTAAAQDNSS--SDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAV--MRLKGSGEL- 196
            |||.:....|...|  .|.|.:..:.::.:..:.:|.:.:..|....:|:|||  :.|..:|.| 
  Fly   130 ALEDIVGHLQSQLSIQLDVKDKAKMADVVKACVGTKFIGKWSDLAVKIALDAVETVTLSENGRLE 194

  Fly   197 ----KSIQIIKKSGGTLGDSFLDEGFLLDKKPGVHQPQR--IENARILIANTPMDTDK------I 249
                :..::.|..||.:.:|.:.:|.:::|.. .|...|  |||.||::.:..::..|      :
  Fly   195 VDIKRYAKVEKIPGGAIEESCVLKGVMINKDV-THPKMRRLIENPRIVLLDCSLEYKKGESQTNV 258

  Fly   250 KVFGSS---------------IKVDSLAKIADLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNY 299
            ::.|..               |..|.:|...||...||     .|..:.:|           |..
  Fly   259 EIIGEQDFTRMLQIEEEFVQRICADIIAVKPDLVFTEK-----GVSDLAQH-----------YLL 307

  Fly   300 PEQLFADARVMSIEHADFDGIERLAYCTGGEIVSTFENPSLVKLGECDV------IEQVMIGEDT 358
            ...:.|..|:...::.      |:|...|..||:..|     :|.|.||      .|...||::.
  Fly   308 KAGITAIRRLRKTDNL------RIARACGATIVNRTE-----ELTEKDVGTGAGLFEVKKIGDEY 361

  Fly   359 LLRFSGVKLGEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLK 423
            ....:..|..:||||::|||::.||:|.:|:|.|||.|....|.|.|::.|||..|...:..:.:
  Fly   362 FTFVTECKEPKACTILLRGASKDILNETERNLQDALHVARNLVLEPRLVAGGGAVEMAASQLLTR 426

  Fly   424 KAAETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHA----QGKQTLGLDMELGK 484
            |..:.|      ..|.|.||..:|..:|.|.|.::.:.::.|||.||    .|....|:|.|.|:
  Fly   427 KQVKGP------YTAVAHALEIIPRTLAQNCGANTIRALTALRAKHASHTGDGVCAWGIDGESGE 485

  Fly   485 VADVRELGITESFAVKRQVLMSASEAAEMILRVDNIIRCAPRR 527
            :.|:....|.|..|||.|...:|.|.|.::||:|:|:..:.:|
  Fly   486 IVDMNVKNIWEPLAVKLQTYKTAVETAILLLRIDDIVSGSKKR 528

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 167/564 (30%)
TCP1_beta 10..527 CDD:239452 165/559 (30%)
CCT3NP_001189236.1 chap_CCT_gamma 7..528 CDD:274085 166/562 (30%)
TCP1_gamma 7..524 CDD:239453 166/558 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C69568969
eggNOG 1 0.900 E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11353
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.