DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and mkks

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:XP_021336215.1 Gene:mkks ZFINID:ZDB-GENE-040426-757 Length:566 Species:Danio rerio

Alignment Length:574 Identity:115/575 (20%)
Similarity:225/575 (39%) Gaps:128/575 (22%)


  Fly    36 DLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILV-----DMSRVQDEEV 95
            :::.:..||.|  ::........|||..|:....:|:.:.:..|..|::.     ..:|..|..:
Zfish    31 NILSTAYGPTG--RLKQIHNNVGGHVLTTSTSTALLKRLEMSEPLLKLISTALQHHTTRYSDSGL 93

  Fly    96 GDGTTSVTVL---------ASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDNSSS 151
            ..|..::|::         .|..::..:.||||   ..:.:.|.....:|.:|.        ||.
Zfish    94 FMGIFTLTLIENTKKYGLRTSTAIKVYKHLVEQ---CNVYLKGDSCGCKVPVEF--------SSC 147

  Fly   152 DEKFRNDLLNIARTTLSSK----ILHQHKDFFANLAVDAVM-----RLKGSGELKSIQIIKKSGG 207
            |     .|:.:|.:.::||    :..:.....::|...|.:     ...|:........|...|.
Zfish   148 D-----SLVALAHSMITSKPACMLDSRETQQISSLITQAFLYSIPCNSSGTACFGRTVTIGIEGQ 207

  Fly   208 TLGDSFLDEGFLLDKKPGVHQPQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEM--- 269
            ::..|.:..|.||| .|.:..|..:|.    :.:.|.   |:.:||.|:..| ::::.|:.:   
Zfish   208 SVNHSSVFPGLLLD-VPEMLLPGDLER----LGDGPF---KVVLFGVSLSGD-ISEVGDVALEVH 263

  Fly   270 ----AEKEKMKEKV---DKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCT 327
                .|::.:::.:   ::::|.|.::|..:::::...:....:..|:.||......:|..|..|
Zfish   264 RGLNPERDLLQQLLKIGEQVVKDKVSLFACQKVVHPVLQHYLREHEVVVIERLGLALMEPFAKIT 328

  Fly   328 GGEIVSTFENPSLVKLGECDVIEQVMI---GEDTLLRFSGVKLGEACTIVIRGATQQILDE---- 385
            |...|::..  |||.:....::..:..   |...||:....|.....|:|:....:.:|:|    
Zfish   329 GARAVASLF--SLVPMEAYGLVAGLCFQDCGSKKLLQLLSSKHAAISTMVLCHRNETMLEELKVC 391

  Fly   386 ---ADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEA-----------IAI 436
               ..|:.|    ||..|::|...:.||||:|..:||.:......|....|           :|:
Zfish   392 AMTCQRAEH----VLRLTLREPYALLGGGCTETQLATHITHMNQSTAPTTAAALGISHSEFLMAV 452

  Fly   437 EAFARALLSLPTAIADNAGYDSAQLVSELRAGH---------AQGKQTLGLDMELGKVADVREL- 491
            |:|..:||    |:|.:..:|....:.:|..||         .:.|.|.|    .|.:.|...| 
Zfish   453 ESFRSSLL----AVALSLEHDGQDCLIDLTYGHRWVMDISSQTEVKHTCG----CGLLEDRSNLE 509

  Fly   492 -----------------------GITESFAVKRQVLMSASEAAEMILRVDNIIR 522
                                   .:.:||:.|...|..|.|.|.::|.|..||:
Zfish   510 KTHLNTACQTFSPVFLENNDTQPKVLDSFSAKLNALNVAVEMASLVLDVKYIIK 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 115/575 (20%)
TCP1_beta 10..527 CDD:239452 115/575 (20%)
mkksXP_021336215.1 Cpn60_TCP1 29..565 CDD:306598 115/575 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.