DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and Hsp60D

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_609656.1 Gene:Hsp60D FlyBaseID:FBgn0032525 Length:558 Species:Drosophila melanogaster

Alignment Length:570 Identity:123/571 (22%)
Similarity:232/571 (41%) Gaps:113/571 (20%)


  Fly    23 ARLSSFIGAIAIGDLVKSTLGPKG----MDKILVATGRNAGHVEVTNDGATILRAVGVDN----P 79
            ||.....|...:.:.|.:||||||    ::::|::.       .:|.||.|:...|.:.|    .
  Fly    26 ARCLLMQGVNVLANAVATTLGPKGRNVLIEQLLISP-------RITKDGITVANNVQLGNRRQDM 83

  Fly    80 AAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQ-KLHPQIIVSGWRQATQVALEALTA 143
            ..::|...:...:.:||||||:.|:||..:..:...::.| |::.|::..|..:.::...:||..
  Fly    84 GVQLLRQATNNTNNKVGDGTTTATILARGIACQGMHVLRQSKVNVQLLREGILEGSRAVCDALGE 148

  Fly   144 AAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLKGSGELKSIQIIKKSGGT 208
            .:|   |.|        .|.:....:|:.....:..|.|..|.::.|..||    :.::|:|...
  Fly   149 MSQ---SVD--------TIGQVEAVAKVALNGDERLAELIGDIILELGDSG----VILLKESHSP 198

  Fly   209 LGDSFLDEGFLLDKKPGVHQP--------QRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIA 265
            ..::.:.||..:  ..|.:.|        ..:||..:|:              :..|:|.:.:| 
  Fly   199 FDEAKIQEGITI--ASGYYSPFFAKQSHTLELENCLLLL--------------TLAKIDQVEQI- 246

  Fly   266 DLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADF-----DGIERLAY 325
             |...|..::||:...|:.......:.:.|:.|   .|....:|.:::...|     :.:|.:|:
  Fly   247 -LPALELARLKERPLLIIAKNFGSDLLKILVLN---NLQGRVQVCAVKAPSFGDEQCEEMEDIAF 307

  Fly   326 CTGGEIVSTFENPSLVKLGECD---VIEQVMIGEDTLL------------------------RFS 363
            .|||.::.  :..||..|.|.|   |:|.|:..::|.|                        .|:
  Fly   308 ATGGHLLE--DASSLADLSEEDLGEVMEAVVDAKETHLLQPINVNEEQVQCRIQDIRELIDEAFT 370

  Fly   364 GVKL-----------GEACTIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALM 417
            .|:|           |...||.:.|.::..:.|.....:|||..:...:.:. ::.||| :..|.
  Fly   371 DVELDRLKTRLGRLQGHLATIFVGGTSELEVSERKDRFNDALHAVRVAISDG-VVPGGG-TAYLR 433

  Fly   418 ATAVLKKAAETPGKEAIAIEAFARALLSLPT-AIADNAGYDSAQLVSELRAGHAQGKQTLGLDME 481
            ...||.:...|...|........:..|.||. .||.|||.|..:::..:    .:|....|.|..
  Fly   434 CIPVLDELPPTDIMELQVGREIVKDALRLPCYTIARNAGVDPNEVLRRV----LKGSGNYGYDAA 494

  Fly   482 LGKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNIIRCAPRR-RVP 530
            .|:..|:...||.:...|.:..:.||:..|.::...:.:|...|.: ::|
  Fly   495 AGEFGDLVVRGIVDPTKVLQSAMTSAAGIASLLATTEVLITKQPTKPKIP 544

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 122/569 (21%)
TCP1_beta 10..527 CDD:239452 122/565 (22%)
Hsp60DNP_609656.1 PTZ00114 13..546 CDD:185455 123/571 (22%)
GroEL 18..536 CDD:239460 121/561 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C68747909
eggNOG 1 0.900 E1_COG0459
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.