DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and HSPD1

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_002147.2 Gene:HSPD1 HGNCID:5261 Length:573 Species:Homo sapiens

Alignment Length:564 Identity:135/565 (24%)
Similarity:238/565 (42%) Gaps:108/565 (19%)


  Fly    23 ARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGV----DNPAAKI 83
            ||.....|...:.|.|..|:||||...|:   .::.|..:||.||.|:.:::.:    .|..||:
Human    36 ARALMLQGVDLLADAVAVTMGPKGRTVII---EQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKL 97

  Fly    84 LVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDN 148
            :.|::...:||.|||||:.||||..:.:|..:.:.:..:|..|    |:...:|::|:.|..:..
Human    98 VQDVANNTNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEI----RRGVMLAVDAVIAELKKQ 158

  Fly   149 S---SSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLKGSGELKSIQIIKKSGGTLG 210
            |   ::.|    ::..:|  |:|:   :..|: ..|:..||:.::...|     .|..|.|.||.
Human   159 SKPVTTPE----EIAQVA--TISA---NGDKE-IGNIISDAMKKVGRKG-----VITVKDGKTLN 208

  Fly   211 DSF-LDEGFLLDKKPGVHQPQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIAD-LEMAEKE 273
            |.. :.||...|:  |...|..|..::    ....:.....|..|..|:.|:..|.. ||:|...
Human   209 DELEIIEGMKFDR--GYISPYFINTSK----GQKCEFQDAYVLLSEKKISSIQSIVPALEIANAH 267

  Fly   274 K-----MKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADF-----DGIERLAYCTG 328
            :     :.|.||.  :....:.:||         |....:|::::...|     :.::.:|..||
Human   268 RKPLVIIAEDVDG--EALSTLVLNR---------LKVGLQVVAVKAPGFGDNRKNQLKDMAIATG 321

  Fly   329 ------------------------GEIVSTFENPSLVKLGECD----------VIEQVMIG---- 355
                                    ||::.|.::..|:| |:.|          :|||:.:.    
Human   322 GAVFGEEGLTLNLEDVQPHDLGKVGEVIVTKDDAMLLK-GKGDKAQIEKRIQEIIEQLDVTTSEY 385

  Fly   356 EDTLLRFSGVKLGEACTIVIRGATQQI-LDEADRSLHDALCVLAATVKESRIIFGGGCSEALMAT 419
            |...|.....||.:...::..|.|..: ::|....:.|||....|.|:|. |:.||||:   :..
Human   386 EKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEG-IVLGGGCA---LLR 446

  Fly   420 AVLKKAAETPGKE--AIAIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMEL 482
            .:....:.||..|  .|.||...|.|......||.|||.:.:.:|.::    .|....:|.|...
Human   447 CIPALDSLTPANEDQKIGIEIIKRTLKIPAMTIAKNAGVEGSLIVEKI----MQSSSEVGYDAMA 507

  Fly   483 GKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNIIRCAPR 526
            |...::.|.||.:...|.|..|:.|:..|.::...:.::...|:
Human   508 GDFVNMVEKGIIDPTKVVRTALLDAAGVASLLTTAEVVVTEIPK 551

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 135/565 (24%)
TCP1_beta 10..527 CDD:239452 135/565 (24%)
HSPD1NP_002147.2 GroEL 28..548 CDD:239460 134/560 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.