DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and Cct7

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_001100073.1 Gene:Cct7 RGDID:1306422 Length:544 Species:Rattus norvegicus

Alignment Length:539 Identity:195/540 (36%)
Similarity:301/540 (56%) Gaps:24/540 (4%)


  Fly     3 MSLNPVRVLKNEAQEEKAEMARLSSFIGAI-AIGDLVKSTLGPKGMDKILVATGRNAGHVEVTND 66
            |...||.:|| |..:....:.:|.|.|.|. .|.:.|::||||:||||::| .||  |...::||
  Rat     1 MMPTPVILLK-EGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIV-DGR--GKATISND 61

  Fly    67 GATILRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWR 131
            |||||:.:.|.:||||.|||:::.||.||||||||||:||:|.|::.:..||:.||||||:..:|
  Rat    62 GATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQIIIRAFR 126

  Fly   132 QATQVALE-----ALTAAAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLK 191
            .|||:|:.     |:|...||....    |..|...|.|.||||::.|.|.|||.:.|||||.|.
  Rat   127 TATQLAVNKIKEIAVTVKKQDKVEQ----RKMLEKCAMTALSSKLISQQKVFFAKMVVDAVMMLD 187

  Fly   192 GSGELKSIQIIKKSGGTLGDSFLDEGFLLDKK---PGVH-QPQRIENARILIANTPMDTDKIKVF 252
            ...:||.|.|.|..||.|.:|.|..|....|.   .|.. ||::.:|.:|.:.|..::. |.:..
  Rat   188 ELLQLKMIGIKKVQGGALEESRLVAGVAFKKTFSYAGFEMQPKKYKNPKIALLNVELEL-KAEKD 251

  Fly   253 GSSIKVDSLAKIADLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADF 317
            .:.|:|.::.....:..||...:.:|::||.:....|.:::..|.:...|.|||..:........
  Rat   252 NAEIRVHTVEDYQAIVDAEWNILYDKLEKIHQSGAKVILSKLPIGDVATQYFADRDMFCAGRVPE 316

  Fly   318 DGIERLAYCTGGEIVSTFENPSLVK--LGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQ 380
            :.::|.....||.|.::..  :|:.  ||.|.|.|:..||.:....|:|....:.|||::||..:
  Rat   317 EDLKRTMMACGGSIQTSVN--ALIPDVLGRCQVFEETQIGGERYNFFTGCPKAKTCTIILRGGAE 379

  Fly   381 QILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLS 445
            |.::|.:||||||:.::...:|...::.|||..|..::..:...:...|||:.:.|.|:|:||..
  Rat   380 QFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEI 444

  Fly   446 LPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMELGKVADVRELGITESFAVKRQVLMSASEA 510
            :|..:.||||:|:..::::|||.||||....|:|:....:||..:..:.|...|:...|.:||||
  Rat   445 IPRQLCDNAGFDATNILNKLRARHAQGGMWYGVDINNEDIADNFQAFVWEPAMVRINALTAASEA 509

  Fly   511 AEMILRVDNIIRCAPRRRV 529
            |.:|:.||..|: .||..|
  Rat   510 ACLIVSVDETIK-NPRSTV 527

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 195/540 (36%)
TCP1_beta 10..527 CDD:239452 191/529 (36%)
Cct7NP_001100073.1 chap_CCT_eta 3..525 CDD:274086 193/534 (36%)
TCP1_eta 5..525 CDD:239456 193/532 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.