DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and Tcp1

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_038714.2 Gene:Tcp1 MGIID:98535 Length:556 Species:Mus musculus

Alignment Length:535 Identity:186/536 (35%)
Similarity:306/536 (57%) Gaps:28/536 (5%)


  Fly    21 EMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAKILV 85
            |..|..:.:.|.:|.::|||:.||.|:||:||   .:.|.|.:||||||||:.:.|::||||:|.
Mouse    15 EAVRSQNVMAAASIANIVKSSFGPVGLDKMLV---DDIGDVTITNDGATILKLLEVEHPAAKVLC 76

  Fly    86 DMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQDNSS 150
            :::.:||:|||||||||.::|:|||:.|::||:||:||..::||:|.|.:.|:..:......|  
Mouse    77 ELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIIN-- 139

  Fly   151 SDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLK---GSGE----LKSIQIIKKSGGT 208
            :||..|:.|:|.|:|::||||:..:.|:|||:.||||:.:|   ..|:    :.|:.|:|..|.:
Mouse   140 TDELGRDCLINAAKTSMSSKIIGINGDYFANMVVDAVLAVKYTDARGQPRYPVNSVNILKAHGRS 204

  Fly   209 LGDSFLDEGFLLDKKPGVH-QPQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAEK 272
            ..:|.|..|:.|:...|.. .|:||.||:|...:..:...|:|: |..:.:....|:..:...|.
Mouse   205 QIESMLINGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKL-GVQVVITDPEKLDQIRQRES 268

  Fly   273 EKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIVSTFEN 337
            :..||::.|||....||.:....|.:...:.|.:|..|::.......::.:|..:|..|:||..|
Mouse   269 DITKERIQKILATGANVILTTGGIDDMYLKYFVEAGAMAVRRVLKRDLKHVAKASGASILSTLAN 333

  Fly   338 P------SLVKLGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHDALCV 396
            .      .:..||:.:.:.|..|.:|.|:.....|...:.:|::|||...:.||.:|||||||||
Mouse   334 LEGEETFEVTMLGQAEEVVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCV 398

  Fly   397 LAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQL 461
            :...::...::.|||..||.::..:...|.....:|.:||..|||:||.:|..:|.||..||..|
Mouse   399 VKRVLELKSVVPGGGAVEAALSIYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDL 463

  Fly   462 VSELRAGHAQGK--------QTLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMILRVD 518
            |::|||.|.:.:        :.:|||:..||..|.::.|:.|...||.:.|..|:|||..|||:|
Mouse   464 VAKLRAFHNEAQVNPERKNLKWIGLDLVHGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRID 528

  Fly   519 NIIRCAPRRRVPDRG 533
            ::|:..|..:....|
Mouse   529 DLIKLHPESKDDKHG 543

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 185/531 (35%)
TCP1_beta 10..527 CDD:239452 185/528 (35%)
Tcp1NP_038714.2 chap_CCT_alpha 5..540 CDD:274081 185/531 (35%)
TCP1_alpha 9..535 CDD:239451 184/526 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D205390at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.