DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and Cct6a

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_033968.1 Gene:Cct6a MGIID:107943 Length:531 Species:Mus musculus

Alignment Length:538 Identity:150/539 (28%)
Similarity:285/539 (53%) Gaps:41/539 (8%)


  Fly     8 VRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILR 72
            |:.|..:|:..:|:.|...:...|..:.|::::.|||||..|:||:   .||.:::|.||..:|.
Mouse     4 VKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVS---GAGDIKLTKDGNVLLH 65

  Fly    73 AVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVA 137
            .:.:.:|.|.::..::..||:..||||||..::..|||::|:..:.:.|||:||..|:..|.:.|
Mouse    66 EMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKA 130

  Fly   138 LEALTAAAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLKGSGE---LKSI 199
            |:.|    :....|.|..|..|:::|||:|.:|:..:..|......||:::.::...|   |..:
Mouse   131 LQFL----EQVKVSKEMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIRKKDEPIDLFMV 191

  Fly   200 QIIKKSGGTLGDSFLDEGFLLDKKPGVHQP---QRIENARILIANTPMDTDKIKVFGSSIKVDSL 261
            :|::....:..|:.|..|.:||.  |...|   :|:|||.||..|..::.:|.:| .|.....|.
Mouse   192 EIMEMKHKSETDTSLIRGLVLDH--GARHPDMKKRVENAYILTCNVSLEYEKTEV-NSGFFYKSA 253

  Fly   262 AKIADLEMAEKEKMKEKVDKILKHK---CN------VFINRQLIYNYPEQLFADARVMSIEHADF 317
            .:...|..||::.::::|.||::.|   |.      |.||::.|..:.....|...::::..|..
Mouse   254 EEREKLVKAERKFIEDRVKKIIELKKKVCGDSDKGFVVINQKGIDPFSLDALAKEGIVALRRAKR 318

  Fly   318 DGIERLAYCTGGEIVSTFE--NPSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEAC------TIV 374
            ..:|||....||..:::|:  ||..  ||...::.:..:||:   :|:.:   |.|      |::
Mouse   319 RNMERLTLACGGIALNSFDDLNPDC--LGHAGLVYEYTLGEE---KFTFI---EKCNNPRSVTLL 375

  Fly   375 IRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAF 439
            ::|..:..|.:...::.|.|..:...:.:..::.|.|..|..:|.|::|......|:..:.::||
Mouse   376 VKGPNKHTLTQIKDAIRDGLRAVKNAIDDGCVVPGAGAVEVALAEALIKYKPSVKGRAQLGVQAF 440

  Fly   440 ARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMELGKVADVRELGITESFAVKRQVL 504
            |.|||.:|..:|.|:|:|..:.:.:::|.|::..|.:|:|:..|:.....|:|:.:::.||:|:|
Mouse   441 ADALLIIPKVLAQNSGFDLQETLVKVQAEHSESGQLVGVDLSTGEPMVAAEMGVWDNYCVKKQLL 505

  Fly   505 MSASEAAEMILRVDNIIR 522
            .|.:..|..||.||.|:|
Mouse   506 HSCTVIATNILLVDEIMR 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 150/539 (28%)
TCP1_beta 10..527 CDD:239452 149/537 (28%)
Cct6aNP_033968.1 chap_CCT_zeta 3..530 CDD:274088 150/539 (28%)
TCP1_zeta 7..526 CDD:239458 149/536 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.