DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and CCT6B

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_006575.2 Gene:CCT6B HGNCID:1621 Length:530 Species:Homo sapiens

Alignment Length:543 Identity:153/544 (28%)
Similarity:293/544 (54%) Gaps:51/544 (9%)


  Fly     8 VRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILR 72
            ::.:.::|:..:|..|...:...|..:.|::::.|||||..|:||:   .||.:::|.||..:|.
Human     4 IKAVNSKAEVARARAALAVNICAARGLQDVLRTNLGPKGTMKMLVS---GAGDIKLTKDGNVLLD 65

  Fly    73 AVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVA 137
            .:.:.:|.|.::..::..||:..||||||..::..|||::|:..:.:.|||:||..|:..|...|
Human    66 EMQIQHPTASLIAKVATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAKIKA 130

  Fly   138 LEALTAAAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLKGSG---ELKSI 199
            ||.|    ::...:.|..|..||::|||:|.:|:..:..|....:.||:|:.::..|   :|..:
Human   131 LEVL----EEVKVTKEMKRKILLDVARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMV 191

  Fly   200 QI--IKKSGGTLGDSFLDEGFLLDKKPGVHQP---QRIENARILIANTPMDTDKIKV-----FGS 254
            :|  :|...||  |:.|.:|.:||.  |...|   :|:|:|.|||.|..::.:|.:|     :.:
Human   192 EIMEMKHKLGT--DTKLIQGLVLDH--GARHPDMKKRVEDAFILICNVSLEYEKTEVNSGFFYKT 252

  Fly   255 SIKVDSLAKIADLEMAEKEKMKEKVDKIL---------KHKCNVFINRQLIYNYPEQLFADARVM 310
            :.:.:.|.|      ||::.::::|.||:         .:|..|.||::.|..:.....|...::
Human   253 AEEKEKLVK------AERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPFSLDSLAKHGIV 311

  Fly   311 SIEHADFDGIERLAYCTGGEIVSTFENPSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEAC---- 371
            ::..|....:|||:...||..|::||:.::..||...::.:..:||:   :|:.:   |.|    
Human   312 ALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEE---KFTFI---EECVNPC 370

  Fly   372 --TIVIRGATQQILDEADRSLHDALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAI 434
              |::::|..:..|.:...::.|.|..:...:::..::.|.|..|..||.|::.......|:..:
Human   371 SVTLLVKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARL 435

  Fly   435 AIEAFARALLSLPTAIADNAGYDSAQLVSELRAGHAQGKQTLGLDMELGKVADVRELGITESFAV 499
            .::|||.|||.:|..:|.|||||..:.:.:::|.|.:.||.:|:|:..|:.....:.|:.:::.|
Human   436 GVQAFADALLIIPKVLAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCV 500

  Fly   500 KRQVLMSASEAAEMILRVDNIIR 522
            |:|:|.|.:..|..||.||.|:|
Human   501 KKQLLHSCTVIATNILLVDEIMR 523

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 153/544 (28%)
TCP1_beta 10..527 CDD:239452 153/542 (28%)
CCT6BNP_006575.2 chap_CCT_zeta 3..530 CDD:274088 153/544 (28%)
TCP1_zeta 23..526 CDD:239458 150/525 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.