DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and CCT2

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_006422.1 Gene:CCT2 HGNCID:1615 Length:535 Species:Homo sapiens

Alignment Length:533 Identity:380/534 (71%)
Similarity:453/534 (85%) Gaps:1/534 (0%)


  Fly     3 MSLNPVRVLKNEAQEEKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDG 67
            :||.||.:.|..|.||:||.|||:|||||||||||||||||||||||||:::||:|. :.|||||
Human     4 LSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAS-LMVTNDG 67

  Fly    68 ATILRAVGVDNPAAKILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQ 132
            ||||:.:||||||||:|||||||||:|||||||||||||:|||||||.|:.:|:|||.|::|||:
Human    68 ATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKIHPQTIIAGWRE 132

  Fly   133 ATQVALEALTAAAQDNSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRLKGSGELK 197
            ||:.|.|||.::|.|:.|.:.|||.||:|||.||||||:|..|||.|..|||:||:||||||.|:
Human   133 ATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFTKLAVEAVLRLKGSGNLE 197

  Fly   198 SIQIIKKSGGTLGDSFLDEGFLLDKKPGVHQPQRIENARILIANTPMDTDKIKVFGSSIKVDSLA 262
            :|.||||.||:|.||:||||||||||.||:||:|||||:||||||.|||||||:|||.::|||.|
Human   198 AIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIANTGMDTDKIKIFGSRVRVDSTA 262

  Fly   263 KIADLEMAEKEKMKEKVDKILKHKCNVFINRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCT 327
            |:|::|.||||||||||::||||..|.|||||||||||||||..|.||:||||||.|:||||..|
Human   263 KVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPEQLFGAAGVMAIEHADFAGVERLALVT 327

  Fly   328 GGEIVSTFENPSLVKLGECDVIEQVMIGEDTLLRFSGVKLGEACTIVIRGATQQILDEADRSLHD 392
            ||||.|||::|.|||||.|.:||:||||||.|:.||||.||||||||:|||||||||||:|||||
Human   328 GGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIHFSGVALGEACTIVLRGATQQILDEAERSLHD 392

  Fly   393 ALCVLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYD 457
            ||||||.|||:||.::||||||.|||.||.:.|..||||||:|:|::|:||..|||.||||||||
Human   393 ALCVLAQTVKDSRTVYGGGCSEMLMAHAVTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYD 457

  Fly   458 SAQLVSELRAGHAQGKQTLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNIIR 522
            ||.||::|||.|::|..|.||||..|.:.|:..|||||||.||||||:||:||||:||||||||:
Human   458 SADLVAQLRAAHSEGNTTAGLDMREGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIK 522

  Fly   523 CAPRRRVPDRGYC 535
            .|||:||||...|
Human   523 AAPRKRVPDHHPC 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 377/527 (72%)
TCP1_beta 10..527 CDD:239452 371/517 (72%)
CCT2NP_006422.1 TCP1_beta 11..527 CDD:239452 370/516 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C172000384
eggNOG 1 0.900 E1_COG0459
Hieranoid 1 1.000
Homologene 1 1.000 H4696
Inparanoid 1 1.050 745 1.000 Inparanoid score I576
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D205390at33208
OrthoFinder 1 1.000 FOG0004412
OrthoInspector 1 1.000 T1075438
orthoMCL 1 0.900 OOG5_127730
Panther 1 1.100 LDO PTHR11353
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1485
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.