DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CCT2 and CCT4

Sequence 1:NP_572524.1 Gene:CCT2 FlyBaseID:FBgn0030086 Length:535 Species:Drosophila melanogaster
Sequence 2:NP_006421.2 Gene:CCT4 HGNCID:1617 Length:539 Species:Homo sapiens

Alignment Length:516 Identity:171/517 (33%)
Similarity:293/517 (57%) Gaps:19/517 (4%)


  Fly    18 EKAEMARLSSFIGAIAIGDLVKSTLGPKGMDKILVATGRNAGHVEVTNDGATILRAVGVDNPAAK 82
            :|....|.|:...|.|:.|.::::|||||||| ::..|:  |.|.:||||||||:.:.|.:|||:
Human    28 DKPAQIRFSNISAAKAVADAIRTSLGPKGMDK-MIQDGK--GDVTITNDGATILKQMQVLHPAAR 89

  Fly    83 ILVDMSRVQDEEVGDGTTSVTVLASELLREAEKLVEQKLHPQIIVSGWRQATQVALEALTAAAQD 147
            :||::|:.||.|.|||||||.::|..||....||:::.:||.||...:::|.:..:|.||..::.
Human    90 MLVELSKAQDIEAGDGTTSVVIIAGSLLDSCTKLLQKGIHPTIISESFQKALEKGIEILTDMSRP 154

  Fly   148 NSSSDEKFRNDLLNIARTTLSSKILHQHKDFFANLAVDAVMRL-----KGSGELKSIQIIKKSGG 207
            ...||   |..|||.|.|:|:||::.|:....:.::|:|||::     ..|.:|:.|:|:||.||
Human   155 VELSD---RETLLNSATTSLNSKVVSQYSSLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGG 216

  Fly   208 TLGDSFLDEGFLLDKKPGVHQPQRIENARILIANTPMDTDKIKVFGSSIKVDSLAKIADLEMAEK 272
            |:.|..|.||.:|.:|.......|:|.|:|.:....:...|..: .:.|.|...|::..:...|:
Human   217 TIDDCELVEGLVLTQKVSNSGITRVEKAKIGLIQFCLSAPKTDM-DNQIVVSDYAQMDRVLREER 280

  Fly   273 EKMKEKVDKILKHKCNVF-----INRQLIYNYPEQLFADARVMSIEHADFDGIERLAYCTGGEIV 332
            ..:...|.:|.|..|||.     |.|..:.:.........::|.|:..:.:.||.:....|.:.|
Human   281 AYILNLVKQIKKTGCNVLLIQKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPV 345

  Fly   333 STFENPSLVKLGECDVIEQVMI-GEDTLLRFSG-VKLGEACTIVIRGATQQILDEADRSLHDALC 395
            :..:..:...||..::.|:|.: |...||:.:| ...|:..|||:||:.:.:::||:||:|||||
Human   346 AHIDQFTADMLGSAELAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALC 410

  Fly   396 VLAATVKESRIIFGGGCSEALMATAVLKKAAETPGKEAIAIEAFARALLSLPTAIADNAGYDSAQ 460
            |:...||:..:|.|||..|..:|..:.:.:....|.|:..:.|||.|:..:|:.:|:|||.:...
Human   411 VIRCLVKKRALIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPIS 475

  Fly   461 LVSELRAGHAQGKQTLGLDMELGKVADVRELGITESFAVKRQVLMSASEAAEMILRVDNII 521
            .|:|||..||||::|.|:::..|.::::.|..:.:...|....|..|:|....||::|:::
Human   476 TVTELRNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVV 536

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CCT2NP_572524.1 PTZ00212 1..530 CDD:185514 171/517 (33%)
TCP1_beta 10..527 CDD:239452 171/517 (33%)
CCT4NP_006421.2 TCP1_delta 25..538 CDD:239454 171/517 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0459
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.