DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and LZTS2

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001305028.1 Gene:LZTS2 HGNCID:29381 Length:669 Species:Homo sapiens

Alignment Length:534 Identity:123/535 (23%)
Similarity:215/535 (40%) Gaps:150/535 (28%)


  Fly   282 LPTEGGQAGGVAAERYGYGSTPSLAPLPTASAQKFGSTTDLRHLAARRRNHRLLQRCSNEDALTL 346
            ||:.|...|.:.....|..:.||.:....:|:.|  ||..|....|.                  
Human   247 LPSHGSGRGALPGPARGVPTGPSHSDSGRSSSSK--STGSLGGRVAG------------------ 291

  Fly   347 DLLSTGSHDRPDGASSKSSGTVVGSSDLTPSPSDSGISE--LEAALKDRDSELSYLRQAMEHNEK 409
            .||.:|:...||.:|....    ......|.|||..:..  ||..|:||::||..||.:::.||.
Human   292 GLLGSGTRASPDSSSCGER----SPPPPPPPPSDEALLHCVLEGKLRDREAELQQLRDSLDENEA 352

  Fly   410 VIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLKQHKLRQSEQVNRLQQ 474
            .:.|..::::.:|:.|.:.||.....|.:..|    :.:|||.||.|||:|.|.:..:...:|.|
Human   353 TMCQAYEERQRHWQREREALREDCAAQAQRAQ----RAQQLLQLQVFQLQQEKRQLQDDFAQLLQ 413

  Fly   475 QLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLEINMKDHAIVSLKHSS 539
            :.:........|:::...|..:||:::|.||:::|||:|||.||||:..|:..|...:|:|:.:.
Human   414 EREQLERRCATLEREQRELGPRLEETKWEVCQKSGEISLLKQQLKESQAELVQKGSELVALRVAL 478

  Fly   540 NRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQQQQQQQQQQQQQQQQ 604
            ..:.::                                 |:..:.:.:..|:..:.::.:.:...
Human   479 REARAT---------------------------------LRVSEGRARGLQEAARARELELEACS 510

  Fly   605 QQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKELSDLAIAHEYGEEPCGR 669
            |:.|:.:|:.:||:::                  .|.|.:|.|.||:                  
Human   511 QELQRHRQEAEQLREK------------------AGQLDAEAAGLRE------------------ 539

  Fly   670 YTRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAAHVATPSCAQELPKLDVLV 734
                                                   ||.| ||  .|.|....|..  :..|
Human   540 ---------------------------------------PPVP-PA--TADPFLLAESD--EAKV 560

  Fly   735 QRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNLELEKRQWSAEKDKVLGYQKQLQ 799
            ||.....|...:..::.|..|       :.:.|::.::.|.:.|.|:..|.|||::|:.||||||
Human   561 QRAAAGVGGSLRAQVERLRVE-------LQRERRRGEEQRDSFEGERLAWQAEKEQVIRYQKQLQ 618

  Fly   800 AHYIQMYQKLRCLD 813
            .:|||||::.|.|:
Human   619 HNYIQMYRRNRQLE 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 14/32 (44%)
LZTS2NP_001305028.1 Required for centrosomal localization. {ECO:0000250} 1..332 25/109 (23%)
SMC_N <329..>537 CDD:330553 62/263 (24%)
Fez1 439..635 CDD:311026 66/315 (21%)
Sufficient for interaction with CTNNB1. {ECO:0000269|PubMed:17000760} 447..669 63/307 (21%)
Sufficient for interaction with KATNB1 and for inhibition of katanin-mediated microtubule severing. {ECO:0000250} 450..669 61/304 (20%)
Nuclear export signal 631..640 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17894158
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_136019
Panther 1 1.100 LDO PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.