DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and LOC795227

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:XP_009299407.1 Gene:LOC795227 ID: Length:755 Species:Danio rerio

Alignment Length:705 Identity:157/706 (22%)
Similarity:277/706 (39%) Gaps:178/706 (25%)


  Fly   160 EEEAMQSLPATLPQQHQQQQQRR--------TTPIAGGSRHQQQQQMGEAEQTSGNFLRPIAFKP 216
            ::......||   |||:.:.:.:        ..|::|...|         .||:.:.:||.||||
Zfish   130 DKNGAHQAPA---QQHKDKSKAKPDNHNPPNILPVSGKLEH---------AQTNDSLVRPSAFKP 182

  Fly   217 I---PFEPDYRIACQQQQQHQQQL---------QLQQQQQQQQQQQQQQQLQLQHQQQQQHQQQH 269
            :   .|.....:.|..|.......         :...|.....|.:|..                
Zfish   183 VVPKSFHSMQNLVCPLQSGSGSAAGAGSGGPGDKAASQSTCGPQWEQDS---------------- 231

  Fly   270 QHQHQQQHQSLQLPTEGGQAGGVAAERYGYGSTP-----SLAPLPTASAQKFGSTTDLRHLAARR 329
                         |:..|...|  |.|.|.||..     ||..|||.:...:|....|..|:|..
Zfish   232 -------------PSSRGTHAG--AGRPGQGSLSDSGRNSLTSLPTYTGSSYGPPPALGPLSAST 281

  Fly   330 RNHRLLQRCSNEDALTLD-------LLSTGSHDRPDGASSKSSGTVVGSSD----LTPSP-SDSG 382
            .:   :.|........:|       |.::.|.....|.||.|...:...||    |.||| ||..
Zfish   282 SH---INRLGTVALEKIDKPGYQNGLSASDSGRSSSGKSSSSYQRLSHMSDAPAPLRPSPNSDDV 343

  Fly   383 ISELEAALKDRDSELS---YLRQAMEHNEKVIFQVQKDKEVYWEHETQRLRLFYEGQQRECQLKL 444
            |.:||..|.:|:.|:|   ::|:.::.:|..|.||.::|:..||.|.:.||..|.|:.::...:.
Zfish   344 IQDLEDRLWEREQEVSKVIHMRRNLDQSEAAIVQVFEEKQRLWEREMEDLRQNYAGRLQQVSRRA 408

  Fly   445 RKMEQLLGLQQFQLKQHKLR-QSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCERN 508
            ::.:|.|..|..:|:|.|.| |.|....|.|:.:|.:......::|.|.| .:||:::|.||::.
Zfish   409 QRSQQALQAQISRLQQDKRRLQDEMTMLLAQREELEKKCLDFRKEQADIL-PRLEETKWEVCQKA 472

  Fly   509 GEIALLKTQLKEAHLEINMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQ 573
            |||:|||.||:::..|:..:...:|.|:                                     
Zfish   473 GEISLLKQQLRDSQGEVTQRAGEMVCLR------------------------------------- 500

  Fly   574 QQHPELQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQV 638
                         .|.:....|.:::::.:...::....:..:|::.....|..|.::..|:|: 
Zfish   501 -------------GQLKDLNAQLREREEAEISLKESFCTKTLELERCEAELQTMLAEVTVLRDK- 551

  Fly   639 IGALTSELAKLRKELSDLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVASP 703
            :.|..:|:::|:|.||:|:........|            ::.::.....:....|.:.|:.:.|
Zfish   552 LSAFEAEVSRLKKALSELSSRTGDTNPP------------DMGQLVSSRSRDRLLSPAETSTSLP 604

  Fly   704 AAQVAPPAPSPAAHVATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQ 768
            |.    |||.|...:.:.....:|.:...|  |.||::.||                 ::...||
Zfish   605 AL----PAPDPLLALQSDDSKVQLQESGDL--RCQLERLQG-----------------ELRLERQ 646

  Fly   769 KLDDFRLNLELEKRQWSAEKDKVLGYQKQLQAHYIQMYQKLRCL----DSAGAAV 819
            :.:...|:...|::.|..||::||.||.|||..|::|.||.:.|    |..|:.:
Zfish   647 QRERQALSFAQERQTWQDEKERVLKYQAQLQLSYVEMLQKNQALEERVDKLGSQI 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 15/32 (47%)
LOC795227XP_009299407.1 iSH2_PI3K_IA_R 349..>446 CDD:304922 29/97 (30%)
FimP 401..>569 CDD:286807 44/220 (20%)
Fez1 464..694 CDD:284284 63/316 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17896834
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T598133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.980

Return to query results.
Submit another query.