DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG15365 and lzts2a

Sequence 1:NP_001285030.1 Gene:CG15365 FlyBaseID:FBgn0030077 Length:828 Species:Drosophila melanogaster
Sequence 2:NP_001139078.1 Gene:lzts2a ZFINID:ZDB-GENE-090313-276 Length:741 Species:Danio rerio

Alignment Length:828 Identity:172/829 (21%)
Similarity:281/829 (34%) Gaps:304/829 (37%)


  Fly    89 GTLKSRQEQRRL-----------------SQKFGSHSNLDDEGVGIGVGMGMGMGLQMRSKFQNI 136
            |||:|...|.:|                 |...|::..|.||.||                ..|.
Zfish    80 GTLRSSSSQEQLLNSQPPLPAKNKSSALISAGNGNYGYLSDEPVG----------------DWND 128

  Fly   137 RQMFELSRSCVGGGGGDGRGGAAEEEAMQSLPATLPQQHQQQQQRRTTPIAGGSRHQQQQQMGEA 201
            ..:...|.|.......|.||       |.......|.        :..|::|.......:::   
Zfish   129 NHVSTCSPSSDTEEPSDNRG-------MNGNIGGPPP--------KLVPVSGRLEKVSMEKI--- 175

  Fly   202 EQTSGNFLRPIAFKPIPFEPDYRIACQQQQQHQQQLQLQQQQQQQQQQQQQQQLQLQHQQQQQHQ 266
                  .:||.||||:                     |.:.:...|....:....|...|     
Zfish   176 ------LIRPTAFKPV---------------------LPKNRNSVQYLSPRSGGSLSESQ----- 208

  Fly   267 QQHQHQHQQQHQSLQLPTEGGQAG-GVAAERYGY----------------GSTPSLAPLPTASAQ 314
                       .||.|...|..|| |...:|..|                ....||:.|||.|:.
Zfish   209 -----------GSLNLLLPGTGAGSGCQEKRNSYSGGRNARSSQSCTMSDSGRNSLSSLPTYSST 262

  Fly   315 KFG---STTDLRHLAARR----RNHRLLQRCSNEDALTLDLLSTGSHDRPDGASSKSSGTV---- 368
            .:.   |.....|:...|    ..|      ||.|:             ...:||||:|::    
Zfish   263 GYSLTQSEVPNGHMETTRSGVGHGH------SNSDS-------------GRSSSSKSTGSLSGRG 308

  Fly   369 -----VGSSDLTPSPS---DSGISELEAALKDRDSELSYLRQAMEHNEKVI-------------- 411
                 .||...:|:|.   :..|.|||..|::||.||..||..::.||..|              
Zfish   309 QPLSDSGSCGRSPAPGEGYEGVIRELEEKLRERDLELQQLRDNLDENEAAICQVMILDFYQFLQQ 373

  Fly   412 -----------------FQVQKDKEVYWEHETQRLRLFYEGQQRECQLKLRKMEQLLGLQQFQLK 459
                             .||.::|:...|.|.:.||.....:.::.|||.::.:|:|.||.|||:
Zfish   374 FDRKLSYTIQLKSSVFSMQVYEEKQKRCEQEMEDLRQSCASKMKQVQLKAQRAQQVLQLQVFQLQ 438

  Fly   460 QHKLRQSEQVNRLQQQLDLARDSSQGLQQQVDALRHQLEDSEWRVCERNGEIALLKTQLKEAHLE 524
            |.|.:..|..::|.|:.:.........:::......:||:::|.||:::|||:|||.|||:...:
Zfish   439 QEKKKLQEDFSQLLQEREALEKRCASFEREQTQFGPRLEETKWEVCQKSGEISLLKQQLKDVQAD 503

  Fly   525 INMKDHAIVSLKHSSNRSSSSSNSNSNKSCDTNTSQSQPKQQAKEEQQQQQHPELQQQQQQQQQQ 589
            :..|...||:||                                 .|.::...|||..|.:.|:.
Zfish   504 LGQKASEIVALK---------------------------------AQLREARSELQASQARSQEA 535

  Fly   590 QQQQQQQQQQQQQQQQQQQQQQQQQQQLKQQHQPDQQQLQKIITLKDQVIGALTSELAKLRKELS 654
            ....:.:..:.:..:.:.|:::.:.:.|:::                  :|.|..|..:|::.: 
Zfish   536 HATARTRTLELEVCENELQRRKSEAELLREK------------------MGRLEEESLRLKEAM- 581

  Fly   655 DLAIAHEYGEEPCGRYTRLKQQLDNLNEICQKTRKYTTTSASPTAVASPAAQVAPPAPSPAA--- 716
                                                    |.||....|:...:...|.|.:   
Zfish   582 ----------------------------------------AVPTPQTLPSKGQSMSLPLPQSRGG 606

  Fly   717 --HVATPSCAQELPKLDVLVQRLQLDQGQGTQQTLDTLIEESTTYAEDIAKLRQKLDDFRLNL-- 777
              |..:|:......:..:|.  .:.|:.:..:|::|.|           ..|||::|..|..|  
Zfish   607 IGHGISPAFRDNSSEEQLLA--YESDEAKAQRQSVDVL-----------HGLRQQVDRLRAELMY 658

  Fly   778 ------------ELEKRQWSAEKDKVLGYQKQLQAHYIQMYQKLRCLD 813
                        |.|:|.|..|||||:.||||||.:|||||::.|.|:
Zfish   659 ERRRSEDQLEGFEDERRVWQEEKDKVIRYQKQLQQNYIQMYRRNRDLE 706

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG15365NP_001285030.1 Syntaphilin <486..>518 CDD:291936 12/32 (38%)
lzts2aNP_001139078.1 Fez1 479..709 CDD:284284 70/334 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C17894509
eggNOG 1 0.900 E1_2CJI9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4758
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000672
OrthoInspector 1 1.000 T598133
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR19354
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5825
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.